BLASTX nr result
ID: Jatropha_contig00024663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024663 (343 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADR71250.1| 40S ribosomal protein S15C [Hevea brasiliensis] 141 7e-32 ref|XP_002528466.1| 30S ribosomal protein S8, putative [Ricinus ... 141 7e-32 gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus... 141 1e-31 ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like... 141 1e-31 ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like... 141 1e-31 ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like... 141 1e-31 tpg|DAA52758.1| TPA: putative ribosomal protein S8 family protei... 141 1e-31 gb|AFW80491.1| putative ribosomal protein S8 family protein [Zea... 141 1e-31 gb|AFK36501.1| unknown [Lotus japonicus] 141 1e-31 gb|AFK34483.1| unknown [Lotus japonicus] 141 1e-31 ref|NP_001238465.1| uncharacterized protein LOC100305645 [Glycin... 141 1e-31 ref|XP_002533107.1| 30S ribosomal protein S8, putative [Ricinus ... 141 1e-31 ref|NP_001146975.1| 40S ribosomal protein S15a [Zea mays] gi|242... 141 1e-31 ref|NP_001146581.1| putative ribosomal protein S8 family protein... 141 1e-31 gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus... 140 2e-31 gb|ESQ36130.1| hypothetical protein EUTSA_v10009092mg [Eutrema s... 140 2e-31 ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like... 140 2e-31 ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like... 140 2e-31 ref|XP_003564569.1| PREDICTED: 40S ribosomal protein S15a-1-like... 140 2e-31 ref|NP_172256.1| 40S ribosomal protein S15a-1 [Arabidopsis thali... 140 2e-31 >gb|ADR71250.1| 40S ribosomal protein S15C [Hevea brasiliensis] Length = 131 Score = 141 bits (356), Expect = 7e-32 Identities = 67/70 (95%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 49 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 108 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 109 AGIMDHEEAR 118 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 2 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 31 >ref|XP_002528466.1| 30S ribosomal protein S8, putative [Ricinus communis] gi|223532142|gb|EEF33949.1| 30S ribosomal protein S8, putative [Ricinus communis] gi|313586475|gb|ADR71248.1| 40S ribosomal protein S15A [Hevea brasiliensis] gi|313586477|gb|ADR71249.1| 40S ribosomal protein S15B [Hevea brasiliensis] Length = 130 Score = 141 bits (356), Expect = 7e-32 Identities = 67/70 (95%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus vulgaris] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVM+RPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMVRPS 30 >ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 162 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 80 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 139 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 140 AGIMDHEEAR 149 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 33 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 62 >ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X4 [Setaria italica] gi|514809577|ref|XP_004979610.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] gi|514749501|ref|XP_004961874.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] gi|514784116|ref|XP_004970511.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >tpg|DAA52758.1| TPA: putative ribosomal protein S8 family protein [Zea mays] Length = 152 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 70 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 129 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 130 AGIMDHEEAR 139 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 23 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 52 >gb|AFW80491.1| putative ribosomal protein S8 family protein [Zea mays] Length = 105 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 23 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 82 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 83 AGIMDHEEAR 92 >gb|AFK36501.1| unknown [Lotus japonicus] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >gb|AFK34483.1| unknown [Lotus japonicus] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|NP_001238465.1| uncharacterized protein LOC100305645 [Glycine max] gi|356497480|ref|XP_003517588.1| PREDICTED: 40S ribosomal protein S15a-1-like [Glycine max] gi|356521929|ref|XP_003529602.1| PREDICTED: 40S ribosomal protein S15a-1-like [Glycine max] gi|356540966|ref|XP_003538955.1| PREDICTED: 40S ribosomal protein S15a-1-like [Glycine max] gi|356541097|ref|XP_003539019.1| PREDICTED: 40S ribosomal protein S15a-1-like [Glycine max] gi|193850547|gb|ACF22877.1| putative ribosomal protein S15 [Glycine max] gi|255626173|gb|ACU13431.1| unknown [Glycine max] gi|462403133|gb|EMJ08690.1| hypothetical protein PRUPE_ppa013307mg [Prunus persica] gi|462403134|gb|EMJ08691.1| hypothetical protein PRUPE_ppa013307mg [Prunus persica] gi|462415054|gb|EMJ19791.1| hypothetical protein PRUPE_ppa013311mg [Prunus persica] gi|508727190|gb|EOY19087.1| Ribosomal protein S8 family protein [Theobroma cacao] gi|508727192|gb|EOY19089.1| Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] gi|508727193|gb|EOY19090.1| Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] gi|508786866|gb|EOY34122.1| Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] gi|508786867|gb|EOY34123.1| Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] gi|508786868|gb|EOY34124.1| Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] gi|508786870|gb|EOY34126.1| Ribosomal protein S8 family protein isoform 5, partial [Theobroma cacao] gi|557526695|gb|ESR38001.1| hypothetical protein CICLE_v10029569mg [Citrus clementina] gi|557538240|gb|ESR49284.1| hypothetical protein CICLE_v10033065mg [Citrus clementina] gi|557538241|gb|ESR49285.1| hypothetical protein CICLE_v10033065mg [Citrus clementina] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|XP_002533107.1| 30S ribosomal protein S8, putative [Ricinus communis] gi|223527098|gb|EEF29279.1| 30S ribosomal protein S8, putative [Ricinus communis] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALK MYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKCMYNAEKRGKRQVMIRPS 30 >ref|NP_001146975.1| 40S ribosomal protein S15a [Zea mays] gi|242051529|ref|XP_002454910.1| hypothetical protein SORBIDRAFT_03g001290 [Sorghum bicolor] gi|195606032|gb|ACG24846.1| 40S ribosomal protein S15a [Zea mays] gi|195610836|gb|ACG27248.1| 40S ribosomal protein S15a [Zea mays] gi|238012922|gb|ACR37496.1| unknown [Zea mays] gi|241926885|gb|EES00030.1| hypothetical protein SORBIDRAFT_03g001290 [Sorghum bicolor] gi|414875628|tpg|DAA52759.1| TPA: putative ribosomal protein S8 family protein isoform 1 [Zea mays] gi|414875629|tpg|DAA52760.1| TPA: putative ribosomal protein S8 family protein isoform 2 [Zea mays] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|NP_001146581.1| putative ribosomal protein S8 family protein isoform 1 [Zea mays] gi|194700340|gb|ACF84254.1| unknown [Zea mays] gi|195652841|gb|ACG45888.1| 40S ribosomal protein S15a [Zea mays] gi|195659239|gb|ACG49087.1| 40S ribosomal protein S15a [Zea mays] gi|195659539|gb|ACG49237.1| 40S ribosomal protein S15a [Zea mays] gi|219887895|gb|ACL54322.1| unknown [Zea mays] gi|413947844|gb|AFW80493.1| putative ribosomal protein S8 family protein isoform 1 [Zea mays] gi|413947845|gb|AFW80494.1| putative ribosomal protein S8 family protein isoform 2 [Zea mays] Length = 130 Score = 141 bits (355), Expect = 1e-31 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEK GKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKIGKRQVMIRPS 30 >gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus vulgaris] Length = 183 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 101 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 160 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 161 AGIMDHEEAR 170 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVM+RPS Sbjct: 54 MVRVSVLNDALKSMYNAEKRGKRQVMVRPS 83 >gb|ESQ36130.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] gi|557095549|gb|ESQ36131.1| hypothetical protein EUTSA_v10009092mg [Eutrema salsugineum] Length = 130 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVR+SVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRISVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] Length = 130 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] Length = 130 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALK MYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKGMYNAEKRGKRQVMIRPS 30 >ref|XP_003564569.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|357133356|ref|XP_003568291.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|470116878|ref|XP_004294600.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] gi|502125485|ref|XP_004498944.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Cicer arietinum] gi|502125487|ref|XP_004498945.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Cicer arietinum] gi|565380677|ref|XP_006356722.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Solanum tuberosum] gi|565380679|ref|XP_006356723.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Solanum tuberosum] gi|565381980|ref|XP_006357333.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|565381982|ref|XP_006357334.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|76573307|gb|ABA46758.1| unknown [Solanum tuberosum] gi|77745497|gb|ABB02647.1| unknown [Solanum tuberosum] gi|301641374|gb|ADK87348.1| 40S ribosomal protein S15a [Triticum aestivum] gi|388511815|gb|AFK43969.1| unknown [Medicago truncatula] gi|474186081|gb|EMS57914.1| 40S ribosomal protein S15a-1 [Triticum urartu] gi|475534291|gb|EMT08545.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] gi|475603932|gb|EMT25572.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] Length = 130 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 30 >ref|NP_172256.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|15238544|ref|NP_200793.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|42571385|ref|NP_973783.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|297796939|ref|XP_002866354.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297815756|ref|XP_002875761.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297849076|ref|XP_002892419.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|565435509|ref|XP_006281312.1| hypothetical protein CARUB_v10027365mg [Capsella rubella] gi|565468332|ref|XP_006292046.1| hypothetical protein CARUB_v10018235mg [Capsella rubella] gi|565491560|ref|XP_006303419.1| hypothetical protein CARUB_v10010626mg [Capsella rubella] gi|1173218|sp|P42798.2|R15A1_ARATH RecName: Full=40S ribosomal protein S15a-1 gi|8439890|gb|AAF75076.1|AC007583_12 Strong similarity to 40S ribosomal protein S15A from Arabidopsis thaliana gb|L27461. EST gb|R30315 comes from this gene [Arabidopsis thaliana] gi|12083302|gb|AAG48810.1|AF332447_1 putative ribosomal protein S15 [Arabidopsis thaliana] gi|13430744|gb|AAK25994.1|AF360284_1 putative ribosomal protein S15 [Arabidopsis thaliana] gi|14423370|gb|AAK62367.1|AF386922_1 40S ribosomal protein S15A [Arabidopsis thaliana] gi|440824|gb|AAA61608.1| ribosomal protein S15 [Arabidopsis thaliana] gi|2150130|gb|AAB58750.1| cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|9757906|dbj|BAB08353.1| 40S ribosomal protein S15A [Arabidopsis thaliana] gi|14334968|gb|AAK59661.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|14596085|gb|AAK68770.1| Putative 40S ribosomal protein S15A [Arabidopsis thaliana] gi|15293213|gb|AAK93717.1| putative ribosomal protein S15 [Arabidopsis thaliana] gi|17104627|gb|AAL34202.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|20148287|gb|AAM10034.1| similar to 40S ribosomal protein S15A [Arabidopsis thaliana] gi|20148721|gb|AAM10251.1| similar to 40S ribosomal protein S15A [Arabidopsis thaliana] gi|21593169|gb|AAM65118.1| cytoplasmic ribosomal protein S15a-like [Arabidopsis thaliana] gi|21593909|gb|AAM65874.1| cytoplasmic ribosomal protein S15a-like [Arabidopsis thaliana] gi|23397065|gb|AAN31818.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|222424838|dbj|BAH20371.1| AT1G07770 [Arabidopsis thaliana] gi|297312189|gb|EFH42613.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297321599|gb|EFH52020.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297338261|gb|EFH68678.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|332009859|gb|AED97242.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|332190056|gb|AEE28177.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|332190057|gb|AEE28178.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|482550016|gb|EOA14210.1| hypothetical protein CARUB_v10027365mg [Capsella rubella] gi|482560753|gb|EOA24944.1| hypothetical protein CARUB_v10018235mg [Capsella rubella] gi|482572130|gb|EOA36317.1| hypothetical protein CARUB_v10010626mg [Capsella rubella] gi|557096900|gb|ESQ37408.1| hypothetical protein EUTSA_v10002722mg [Eutrema salsugineum] gi|557101993|gb|ESQ42356.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101994|gb|ESQ42357.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101995|gb|ESQ42358.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101996|gb|ESQ42359.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] Length = 130 Score = 140 bits (352), Expect = 2e-31 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = -3 Query: 221 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFGYIVLTTS 42 GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFD+GVKEIEGWTARLLPSRQFGYIVLTTS Sbjct: 48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTS 107 Query: 41 AGIMDHEDGQ 12 AGIMDHE+ + Sbjct: 108 AGIMDHEEAR 117 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 252 MVRVSVLNDALKSMYNAEKRGKRQVMIRPS 341 MVR+SVLNDALKSMYNAEKRGKRQVMIRPS Sbjct: 1 MVRISVLNDALKSMYNAEKRGKRQVMIRPS 30