BLASTX nr result
ID: Jatropha_contig00024584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024584 (322 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520450.1| hypothetical protein RCOM_0731250 [Ricinus c... 85 1e-14 gb|ERP56830.1| hypothetical protein POPTR_0009s04520g [Populus t... 64 2e-08 >ref|XP_002520450.1| hypothetical protein RCOM_0731250 [Ricinus communis] gi|223540292|gb|EEF41863.1| hypothetical protein RCOM_0731250 [Ricinus communis] Length = 1329 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -1 Query: 157 GLQQTHSQHPVQSLAQHLTSQPNQPVNPHLQPQLQHSSANAVTGHHSYSQPQ 2 GL QTH+Q+P+Q + Q SQPN PVNPH+QPQ QHSSA+AVTGHHSY QPQ Sbjct: 387 GLPQTHAQYPMQPIPQPFASQPNHPVNPHVQPQPQHSSAHAVTGHHSYPQPQ 438 >gb|ERP56830.1| hypothetical protein POPTR_0009s04520g [Populus trichocarpa] Length = 1315 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 127 VQSLAQHLTSQPNQPVNPHLQPQLQHSSANAVTGHHSYSQPQ 2 +Q L Q L SQP+Q VNP+LQ Q QHSS NAVTGHHSY QPQ Sbjct: 383 LQPLPQSLASQPSQTVNPNLQTQPQHSSVNAVTGHHSYQQPQ 424