BLASTX nr result
ID: Jatropha_contig00024535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024535 (278 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535856.1| conserved hypothetical protein [Ricinus comm... 65 1e-16 ref|YP_173443.1| hypothetical protein NitaMp105 [Nicotiana tabac... 68 3e-16 emb|CBI33440.3| unnamed protein product [Vitis vinifera] 66 5e-09 >ref|XP_002535856.1| conserved hypothetical protein [Ricinus communis] gi|223521723|gb|EEF26527.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 65.5 bits (158), Expect(3) = 1e-16 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 118 RGTEHNMFYPQPPSVISNLNPLFLFTSTLRATTSSPLS 231 +G NMFYPQPPSVISNLN LFLFTSTLRATTSSP + Sbjct: 48 KGEAPNMFYPQPPSVISNLNQLFLFTSTLRATTSSPFT 85 Score = 42.0 bits (97), Expect(3) = 1e-16 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 45 DAYASSLSIEFPSFAVYGEAKETRA 119 DAYASSLSIEFPSFAVYGE + A Sbjct: 27 DAYASSLSIEFPSFAVYGEGDKGEA 51 Score = 24.3 bits (51), Expect(3) = 1e-16 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 104 EGDKGEAPNI 133 EGDKGEAPN+ Sbjct: 45 EGDKGEAPNM 54 >ref|YP_173443.1| hypothetical protein NitaMp105 [Nicotiana tabacum] gi|56806607|dbj|BAD83508.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 160 Score = 67.8 bits (164), Expect(3) = 3e-16 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 118 RGTEHNMFYPQPPSVISNLNPLFLFTSTLRATTSSPLSRV 237 +G NMFYPQPPSVISNLN LFLFTSTLRATTSSP +R+ Sbjct: 118 KGEAPNMFYPQPPSVISNLNSLFLFTSTLRATTSSPFTRL 157 Score = 38.1 bits (87), Expect(3) = 3e-16 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 45 DAYASSLSIEFPSFAVYGEAKETRA 119 DAYASSLSI FPSF+VYGE + A Sbjct: 97 DAYASSLSIGFPSFSVYGEGDKGEA 121 Score = 24.3 bits (51), Expect(3) = 3e-16 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 104 EGDKGEAPNI 133 EGDKGEAPN+ Sbjct: 115 EGDKGEAPNM 124 >emb|CBI33440.3| unnamed protein product [Vitis vinifera] Length = 35 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 136 MFYPQPPSVISNLNPLFLFTSTLRATTSSPL 228 MFYPQPPSVISNLNPLFLFTSTLRATTSSPL Sbjct: 1 MFYPQPPSVISNLNPLFLFTSTLRATTSSPL 31