BLASTX nr result
ID: Jatropha_contig00024475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024475 (458 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY80143.1| lipoic acid synthase [Jatropha curcas] 64 1e-10 >gb|AEY80143.1| lipoic acid synthase [Jatropha curcas] Length = 201 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 33/55 (60%), Positives = 33/55 (60%) Frame = +1 Query: 166 KLLFNPXXXXXXXLCVAAPHXXXXXXXXXXXXXXXHHRCSTTSASITTSGKTNRL 330 KLLFNP LCVAAPH HHRCSTTSASITTSGKTNRL Sbjct: 37 KLLFNPSSSSSCSLCVAAPHSKINNDMMIISSNIKHHRCSTTSASITTSGKTNRL 91 Score = 26.9 bits (58), Expect(2) = 1e-10 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 422 KKIGARVRVKVP 457 KKIGARVRVKVP Sbjct: 122 KKIGARVRVKVP 133