BLASTX nr result
ID: Jatropha_contig00024378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024378 (174 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56176.1| major allergen Pru ar [Jatropha curcas] 57 2e-06 >gb|ADU56176.1| major allergen Pru ar [Jatropha curcas] Length = 157 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 54 STAVPPGKLFKALLFEAHVYAPNILHQFIKSIDILHGHG 170 +TAVPP KL+KALL EAHVYAP IL Q IKSI +L G G Sbjct: 11 ATAVPPAKLYKALLLEAHVYAPKILPQSIKSIVLLQGDG 49