BLASTX nr result
ID: Jatropha_contig00024199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024199 (570 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 101 1e-19 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 101 bits (252), Expect = 1e-19 Identities = 53/73 (72%), Positives = 58/73 (79%) Frame = -3 Query: 568 QKKISPDRYMMMLNRDQDRERGLPFCCVGSSRQKHS*E*MVLIPMFFLVSFGFESLPLPV 389 Q + SPDRYMMMLNRDQDRERGLP C + ++ MVLIPMFFLVSFGFESLPL V Sbjct: 32 QSQFSPDRYMMMLNRDQDRERGLPLCWLFEAKALIG---MVLIPMFFLVSFGFESLPLHV 88 Query: 388 LTRLFQAVILDFF 350 LTRL +AVILDFF Sbjct: 89 LTRLLKAVILDFF 101