BLASTX nr result
ID: Jatropha_contig00024136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024136 (248 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ09227.1| hypothetical protein PRUPE_ppa003079mg [Prunus pe... 55 9e-08 ref|XP_004139354.1| PREDICTED: SNW domain-containing protein 1-l... 47 7e-06 ref|XP_004149509.1| PREDICTED: puff-specific protein Bx42-like [... 47 7e-06 >gb|EMJ09227.1| hypothetical protein PRUPE_ppa003079mg [Prunus persica] Length = 606 Score = 55.1 bits (131), Expect(2) = 9e-08 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +2 Query: 86 KVQKDVMMRKREGKNLNLRALAQKARSERTGXXXXXXXXXXXDKSAMGVDMAGD 247 KVQK+++M+++E K LRALAQKARSERTG DK+ M DM GD Sbjct: 318 KVQKEMIMKEKEKKEQELRALAQKARSERTGAAPPASVPMPSDKTTMDTDMRGD 371 Score = 26.6 bits (57), Expect(2) = 9e-08 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 34 ALYVAEQKAREAV 72 +LYVAEQKAREAV Sbjct: 301 SLYVAEQKAREAV 313 >ref|XP_004139354.1| PREDICTED: SNW domain-containing protein 1-like [Cucumis sativus] gi|449487951|ref|XP_004157882.1| PREDICTED: SNW domain-containing protein 1-like isoform 1 [Cucumis sativus] gi|449487953|ref|XP_004157883.1| PREDICTED: SNW domain-containing protein 1-like isoform 2 [Cucumis sativus] Length = 605 Score = 47.4 bits (111), Expect(2) = 7e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 86 KVQKDVMMRKREGKNLNLRALAQKARSERTG 178 KVQK+++M+++E K L LRALAQKARSERTG Sbjct: 315 KVQKEMLMKQKEKKELELRALAQKARSERTG 345 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 34 ALYVAEQKAREAV 72 ALYVAEQKAREAV Sbjct: 298 ALYVAEQKAREAV 310 >ref|XP_004149509.1| PREDICTED: puff-specific protein Bx42-like [Cucumis sativus] gi|449523876|ref|XP_004168949.1| PREDICTED: puff-specific protein Bx42-like [Cucumis sativus] Length = 603 Score = 47.4 bits (111), Expect(2) = 7e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 86 KVQKDVMMRKREGKNLNLRALAQKARSERTG 178 KVQK+++M+++E K L LRALAQKARSERTG Sbjct: 315 KVQKEMLMKQKEKKELELRALAQKARSERTG 345 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 34 ALYVAEQKAREAV 72 ALYVAEQKAREAV Sbjct: 298 ALYVAEQKAREAV 310