BLASTX nr result
ID: Jatropha_contig00023687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00023687 (344 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523838.1| conserved hypothetical protein [Ricinus comm... 89 4e-16 emb|CBI28290.3| unnamed protein product [Vitis vinifera] 83 4e-14 ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vi... 83 4e-14 emb|CAN73123.1| hypothetical protein VITISV_024229 [Vitis vinifera] 83 4e-14 ref|XP_002328231.1| predicted protein [Populus trichocarpa] gi|5... 80 3e-13 gb|EEE87565.2| hypothetical protein POPTR_0009s16150g [Populus t... 79 4e-13 ref|XP_004291698.1| PREDICTED: uncharacterized protein RP120-lik... 78 1e-12 ref|XP_002313610.1| predicted protein [Populus trichocarpa] 77 2e-12 ref|NP_568417.1| uncharacterized protein [Arabidopsis thaliana] ... 77 2e-12 dbj|BAB08333.1| unnamed protein product [Arabidopsis thaliana] 77 2e-12 gb|EMJ08671.1| hypothetical protein PRUPE_ppa006236mg [Prunus pe... 77 3e-12 gb|ESW22048.1| hypothetical protein PHAVU_005G122300g [Phaseolus... 76 4e-12 ref|XP_003540252.1| PREDICTED: uncharacterized protein RP120-lik... 75 6e-12 gb|ESR37432.1| hypothetical protein CICLE_v10028505mg [Citrus cl... 75 8e-12 gb|EOY33384.1| Mitochondrial fission protein [Theobroma cacao] 75 1e-11 ref|XP_002874065.1| hypothetical protein ARALYDRAFT_910225 [Arab... 75 1e-11 gb|EPS71612.1| hypothetical protein M569_03146 [Genlisea aurea] 74 1e-11 gb|ESQ42193.1| hypothetical protein EUTSA_v10013630mg [Eutrema s... 74 2e-11 ref|XP_006290047.1| hypothetical protein CARUB_v10003681mg [Caps... 73 3e-11 ref|XP_003543425.1| PREDICTED: uncharacterized protein RP120-lik... 73 4e-11 >ref|XP_002523838.1| conserved hypothetical protein [Ricinus communis] gi|223536926|gb|EEF38564.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 89.4 bits (220), Expect = 4e-16 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P GVP+IF+TGANSV RRA++IGNGFPGSEN S+ LVRAL LSDN Sbjct: 1 MRPIRLPEPPSPTMGVPEIFETGANSVIRRAVVIGNGFPGSENQSLGLVRALGLSDN 57 >emb|CBI28290.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/58 (70%), Positives = 45/58 (77%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDNQ 344 M PI LPE P P GVP+IF+ GA SV RRA+IIGNGFPGSEN SI LVRAL L+D Q Sbjct: 1 MRPIRLPEPPGPSLGVPEIFEGGAYSVIRRAVIIGNGFPGSENQSIGLVRALGLADKQ 58 >ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vitis vinifera] Length = 420 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/58 (70%), Positives = 45/58 (77%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDNQ 344 M PI LPE P P GVP+IF+ GA SV RRA+IIGNGFPGSEN SI LVRAL L+D Q Sbjct: 1 MRPIRLPEPPGPSLGVPEIFEGGAYSVIRRAVIIGNGFPGSENQSIGLVRALGLADKQ 58 >emb|CAN73123.1| hypothetical protein VITISV_024229 [Vitis vinifera] Length = 152 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/58 (70%), Positives = 45/58 (77%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDNQ 344 M PI LPE P P GVP+IF+ GA SV RRA+IIGNGFPGSEN SI LVRAL L+D Q Sbjct: 1 MRPIRLPEPPGPSLGVPEIFEGGAYSVIRRAVIIGNGFPGSENQSIGLVRALGLADKQ 58 >ref|XP_002328231.1| predicted protein [Populus trichocarpa] gi|550341522|gb|ERP62551.1| hypothetical protein POPTR_0004s20790g [Populus trichocarpa] Length = 424 Score = 79.7 bits (195), Expect = 3e-13 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSD 338 M PI LPE P P GVP+IF+ GA SV RRA++IGNGFPGSEN S+ LVRAL L D Sbjct: 1 MKPIRLPEPPSPTMGVPEIFENGAYSVIRRAVVIGNGFPGSENQSLGLVRALGLYD 56 >gb|EEE87565.2| hypothetical protein POPTR_0009s16150g [Populus trichocarpa] Length = 424 Score = 79.3 bits (194), Expect = 4e-13 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P GVP+IF+ G SV RRA++IGNGFPGSEN S+ L+ AL L+DN Sbjct: 1 MRPIRLPEPPSPTLGVPEIFENGGYSVIRRAVVIGNGFPGSENQSLGLIHALGLADN 57 >ref|XP_004291698.1| PREDICTED: uncharacterized protein RP120-like [Fragaria vesca subsp. vesca] Length = 421 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSD 338 M PI LPE P P G P+IF+ G + V RRA++IGNGFPGSEN SI LVRAL L+D Sbjct: 1 MRPIRLPEPPSPKLGTPEIFEGGVSGVVRRAVVIGNGFPGSENQSIGLVRALGLAD 56 >ref|XP_002313610.1| predicted protein [Populus trichocarpa] Length = 424 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P GVP+IF+ G SV RRA++IGNG PGSEN S+ L+ AL L+DN Sbjct: 1 MRPIRLPEPPSPTLGVPEIFENGGYSVIRRAVVIGNGIPGSENQSLGLIHALGLADN 57 >ref|NP_568417.1| uncharacterized protein [Arabidopsis thaliana] gi|75163635|sp|Q93YN4.1|ELM1_ARATH RecName: Full=Mitochondrial fission protein ELM1; AltName: Full=Protein ELONGATED MITOCHONDRIA 1 gi|16649091|gb|AAL24397.1| Unknown protein [Arabidopsis thaliana] gi|22136260|gb|AAM91208.1| unknown protein [Arabidopsis thaliana] gi|195183710|dbj|BAG66280.1| mitochondrial fission protein [Arabidopsis thaliana] gi|332005632|gb|AED93015.1| uncharacterized protein AT5G22350 [Arabidopsis thaliana] Length = 427 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/58 (67%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIF-QTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LP+ P TGVPDIF Q G+++V RRA++IGNGFPGSEN I LVRAL LSDN Sbjct: 1 MRPILLPDPPSLSTGVPDIFEQGGSHNVVRRAVVIGNGFPGSENQCIGLVRALGLSDN 58 >dbj|BAB08333.1| unnamed protein product [Arabidopsis thaliana] Length = 491 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/58 (67%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIF-QTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LP+ P TGVPDIF Q G+++V RRA++IGNGFPGSEN I LVRAL LSDN Sbjct: 1 MRPILLPDPPSLSTGVPDIFEQGGSHNVVRRAVVIGNGFPGSENQCIGLVRALGLSDN 58 >gb|EMJ08671.1| hypothetical protein PRUPE_ppa006236mg [Prunus persica] Length = 421 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSD 338 M PI LPE P P G P+IF+ G V RRA++IGNGFPGSEN SI LVRAL L+D Sbjct: 1 MRPIQLPEPPSPKLGTPEIFEGGVYGVVRRAVVIGNGFPGSENQSIGLVRALGLAD 56 >gb|ESW22048.1| hypothetical protein PHAVU_005G122300g [Phaseolus vulgaris] Length = 418 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = +3 Query: 171 MIPITLPETPRPPT--GVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P G PDIF++G +++ RRA+IIGNGFP SENHSI L+RAL LS N Sbjct: 1 MKPIQLPEPPSPTAARGTPDIFESGLHTIVRRAVIIGNGFPSSENHSIGLLRALGLSHN 59 >ref|XP_003540252.1| PREDICTED: uncharacterized protein RP120-like [Glycine max] Length = 420 Score = 75.5 bits (184), Expect = 6e-12 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = +3 Query: 171 MIPITLPETPRPPT--GVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P G PDIF++G +++ RRA++IGNGFP SENHSI L+RAL LS N Sbjct: 3 MKPIQLPEPPSPTAARGTPDIFESGVHTLVRRAVVIGNGFPSSENHSIGLLRALGLSHN 61 >gb|ESR37432.1| hypothetical protein CICLE_v10028505mg [Citrus clementina] Length = 425 Score = 75.1 bits (183), Expect = 8e-12 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSD 338 M PI LPE P GVP+IF GA SV RRA++IGNG+PGSEN + LVRAL LSD Sbjct: 1 MRPIRLPEPPTQTMGVPEIFAAGAYSVIRRAVVIGNGYPGSENQCVGLVRALGLSD 56 >gb|EOY33384.1| Mitochondrial fission protein [Theobroma cacao] Length = 420 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLS 335 M PI LPE P P G+P+IF+ GA +V RRA++IGNG PGSEN SI LVRAL LS Sbjct: 1 MRPIRLPEPPSPTMGMPEIFEGGAYNVVRRAVVIGNGSPGSENQSIGLVRALGLS 55 >ref|XP_002874065.1| hypothetical protein ARALYDRAFT_910225 [Arabidopsis lyrata subsp. lyrata] gi|297319902|gb|EFH50324.1| hypothetical protein ARALYDRAFT_910225 [Arabidopsis lyrata subsp. lyrata] Length = 427 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIF-QTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LP+ P TGVPDIF Q GA +V RRA++IGNGFPGSEN I LVRAL L++N Sbjct: 1 MRPILLPDPPSLSTGVPDIFEQGGAQNVVRRAVVIGNGFPGSENQCIGLVRALGLANN 58 >gb|EPS71612.1| hypothetical protein M569_03146 [Genlisea aurea] Length = 428 Score = 74.3 bits (181), Expect = 1e-11 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 3/61 (4%) Frame = +3 Query: 171 MIPITLPETPRPPT---GVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LPE P P G+PDIF+ G +SV RRA+IIGNGFP +EN SI LVRAL LS+ Sbjct: 1 MKPIKLPEPPGSPPPMGGIPDIFEGGIHSVVRRAVIIGNGFPATENQSIGLVRALGLSEK 60 Query: 342 Q 344 Q Sbjct: 61 Q 61 >gb|ESQ42193.1| hypothetical protein EUTSA_v10013630mg [Eutrema salsugineum] Length = 427 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/58 (63%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIF-QTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LP+ P TGVP+IF Q GA +V RRA++IGNGFPGSEN I LVRAL L++N Sbjct: 1 MRPILLPDPPSLSTGVPEIFEQGGAQNVVRRAVVIGNGFPGSENQCIGLVRALGLAEN 58 >ref|XP_006290047.1| hypothetical protein CARUB_v10003681mg [Capsella rubella] gi|482558753|gb|EOA22945.1| hypothetical protein CARUB_v10003681mg [Capsella rubella] Length = 427 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/58 (63%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +3 Query: 171 MIPITLPETPRPPTGVPDIF-QTGANSVTRRAIIIGNGFPGSENHSISLVRALSLSDN 341 M PI LP+ P +GVPDIF Q G +V RRA++IGNGFPGSEN I LVRAL L+DN Sbjct: 1 MRPILLPDPPSLSSGVPDIFEQGGPQNVVRRAVVIGNGFPGSENQCIGLVRALGLADN 58 >ref|XP_003543425.1| PREDICTED: uncharacterized protein RP120-like [Glycine max] Length = 420 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = +3 Query: 177 PITLPETPRPPT--GVPDIFQTGANSVTRRAIIIGNGFPGSENHSISLVRALSLS 335 PI LPE P P G PDIF++G +++ RRA++IGNGFP SENHSI L+RAL LS Sbjct: 5 PILLPEPPSPTAARGTPDIFESGVHTLVRRAVVIGNGFPSSENHSIGLLRALGLS 59