BLASTX nr result
ID: Jatropha_contig00023476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00023476 (293 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003587237.1| ATPase subunit 8 [Citrullus lanatus] gi|2591... 67 7e-18 ref|YP_003587373.1| ATPase subunit 8 [Cucurbita pepo] gi|2591568... 65 6e-17 ref|YP_717120.1| hypothetical protein BrnapMp022 [Brassica napus... 64 7e-17 gb|AAO48983.1| mitochondrial membrane associated protein [Brassi... 64 7e-17 gb|ESQ38797.1| hypothetical protein EUTSA_v10029138mg [Eutrema s... 64 8e-17 ref|YP_717104.1| hypothetical protein BrnapMp005 [Brassica napus... 64 8e-17 ref|NP_085508.1| orfB [Arabidopsis thaliana] gi|15226097|ref|NP_... 64 8e-17 ref|YP_006665999.1| ATP synthase subunit 8 (mitochondrion) [Raph... 64 8e-17 sp|Q06564.1|YMF19_RAPSA RecName: Full=Putative ATP synthase prot... 64 8e-17 gb|ABK58589.1| OrfB [Brassica juncea var. tumida] gi|164419277|g... 64 8e-17 dbj|BAA02858.1| unnamed protein product [Brassica napus] 64 8e-17 ref|YP_004927504.1| atp8 (mitochondrion) [Brassica oleracea] gi|... 64 8e-17 gb|ACU14722.1| unknown [Glycine max] 62 8e-17 dbj|BAD83520.2| orfB protein (mitochondrion) [Nicotiana tabacum] 62 1e-16 ref|NP_064090.2| atp8 gene product (mitochondrion) [Beta vulgari... 60 4e-16 ref|YP_005090498.1| ATPase subunit 8 (mitochondrion) [Lotus japo... 60 4e-16 ref|YP_005090447.1| ATPase subunit 8 (mitochondrion) [Millettia ... 60 4e-16 gb|AEN56101.1| ATPase subunit 8 [Cucumis melo subsp. melo] 63 5e-16 gb|AAB41357.1| unknown [Brassica napus] 61 6e-16 pir||JQ1512 hypothetical 26.2K protein (atp6 5' region) - rape m... 61 6e-16 >ref|YP_003587237.1| ATPase subunit 8 [Citrullus lanatus] gi|259156763|gb|ACV96625.1| ATPase subunit 8 [Citrullus lanatus] Length = 159 Score = 66.6 bits (161), Expect(2) = 7e-18 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F LTFYIFICNDGDGVLGISRILKLRNQLVSH Sbjct: 19 FFLTFYIFICNDGDGVLGISRILKLRNQLVSH 50 Score = 49.3 bits (116), Expect(2) = 7e-18 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFFL 207 MPQLDK TYFTQFFWLCLFFL Sbjct: 1 MPQLDKLTYFTQFFWLCLFFL 21 >ref|YP_003587373.1| ATPase subunit 8 [Cucurbita pepo] gi|259156804|gb|ACV96665.1| ATPase subunit 8 [Cucurbita pepo] Length = 160 Score = 65.1 bits (157), Expect(2) = 6e-17 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQLVSH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLVSH 50 Score = 47.8 bits (112), Expect(2) = 6e-17 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDK TYFTQFFWLCLFF Sbjct: 1 MPQLDKLTYFTQFFWLCLFF 20 >ref|YP_717120.1| hypothetical protein BrnapMp022 [Brassica napus] gi|1800191|gb|AAB41354.1| unknown (mitochondrion) [Brassica napus] gi|37591066|dbj|BAC98868.1| hypothetical protein [Brassica napus] gi|114148847|gb|ABI51268.1| cytoplasmic male sterility protein [Brassica rapa subsp. pekinensis] Length = 222 Score = 63.9 bits (154), Expect(2) = 7e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 7e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >gb|AAO48983.1| mitochondrial membrane associated protein [Brassica juncea] Length = 220 Score = 63.9 bits (154), Expect(2) = 7e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 7e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >gb|ESQ38797.1| hypothetical protein EUTSA_v10029138mg [Eutrema salsugineum] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >ref|YP_717104.1| hypothetical protein BrnapMp005 [Brassica napus] gi|37591050|dbj|BAC98852.1| hypothetical protein [Brassica napus] gi|371925859|gb|AEX57660.1| Atp8 (mitochondrion) [Raphanus sativus] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >ref|NP_085508.1| orfB [Arabidopsis thaliana] gi|15226097|ref|NP_178793.1| ATPase, F0 complex, subunit 8 [Arabidopsis thaliana] gi|44888349|sp|P93303.1|YMF19_ARATH RecName: Full=ATP synthase protein YMF19; AltName: Full=Mitochondrial protein YMF19 gi|1785709|emb|CAA69732.1| orfB [Arabidopsis thaliana] gi|20198288|gb|AAM15504.1| hypothetical protein [Arabidopsis thaliana] gi|67848450|gb|AAY82258.1| hypothetical protein At2g07708 [Arabidopsis thaliana] gi|109946563|gb|ABG48460.1| At2g07707 [Arabidopsis thaliana] gi|330251001|gb|AEC06095.1| ATPase, F0 complex, subunit 8 [Arabidopsis thaliana] gi|339773231|gb|AEK01255.1| atp8 [Arabidopsis thaliana] gi|339773268|gb|AEK01291.1| atp8 [Arabidopsis thaliana] gi|339773290|gb|AEK01312.1| atp8 [Arabidopsis thaliana] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >ref|YP_006665999.1| ATP synthase subunit 8 (mitochondrion) [Raphanus sativus] gi|288881|emb|CAA79333.1| orfB [Raphanus sativus] gi|3273212|dbj|BAA31152.1| unnamed protein product [Raphanus sativus] gi|8096223|dbj|BAA96103.1| unnamed protein product [Raphanus sativus] gi|400278319|dbj|BAM36242.1| ATP synthase subunit 8 (mitochondrion) [Raphanus sativus] gi|1096966|prf||2113215B ORF B Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >sp|Q06564.1|YMF19_RAPSA RecName: Full=Putative ATP synthase protein YMF19; AltName: Full=Mitochondrial protein YMF19 gi|288878|emb|CAA79331.1| orfB [Raphanus sativus] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >gb|ABK58589.1| OrfB [Brassica juncea var. tumida] gi|164419277|gb|ABY54901.1| CMS-associated protein [Brassica juncea] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >dbj|BAA02858.1| unnamed protein product [Brassica napus] Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >ref|YP_004927504.1| atp8 (mitochondrion) [Brassica oleracea] gi|353526488|ref|YP_004927559.1| atp8 (mitochondrion) [Brassica carinata] gi|353526657|ref|YP_004927824.1| atp8 (mitochondrion) [Brassica rapa subsp. oleifera] gi|353531341|ref|YP_004927727.1| atp8 (mitochondrion) [Brassica juncea] gi|732152|sp|Q03152.1|YMF19_BRANA RecName: Full=Putative ATP synthase protein YMF19; AltName: Full=Mitochondrial protein YMF19 gi|419764|pir||S30091 hypothetical protein 158 - radish mitochondrion gi|14386|emb|CAA78272.1| ORF158 (not yet identified) [Brassica sp.] gi|8096225|dbj|BAA96104.1| unnamed protein product [Raphanus sativus] gi|8096227|dbj|BAA96105.1| unnamed protein product [Raphanus raphanistrum] gi|335354845|gb|AEH43401.1| atp8 [Brassica rapa subsp. oleifera] gi|335354977|gb|AEH43532.1| atp8 [Brassica oleracea] gi|335355019|gb|AEH43573.1| atp8 [Brassica carinata] gi|335355074|gb|AEH43627.1| atp8 [Brassica juncea] gi|339511270|emb|CBX48325.1| unnamed protein product [Brassica napus] gi|400278289|dbj|BAM36213.1| ATP synthase subunit 8 (mitochondrion) [Raphanus sativus] gi|443298126|gb|AGC81670.1| ATPase subunit 8 (mitochondrion) [Raphanus sativus] gi|384295|prf||1905379B cytoplasmic male sterility-associated protein Length = 158 Score = 63.9 bits (154), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 8e-17 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >gb|ACU14722.1| unknown [Glycine max] Length = 151 Score = 62.4 bits (150), Expect(2) = 8e-17 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKLRNQLVS+ Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLRNQLVSN 50 Score = 50.1 bits (118), Expect(2) = 8e-17 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYFTQFFWLCLFF Sbjct: 1 MPQLDKFTYFTQFFWLCLFF 20 >dbj|BAD83520.2| orfB protein (mitochondrion) [Nicotiana tabacum] Length = 156 Score = 62.0 bits (149), Expect(2) = 1e-16 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYI ICNDGDGVLGISRILKLRNQLVSH Sbjct: 19 FFFTFYISICNDGDGVLGISRILKLRNQLVSH 50 Score = 50.1 bits (118), Expect(2) = 1e-16 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYFTQFFWLCLFF Sbjct: 1 MPQLDKFTYFTQFFWLCLFF 20 >ref|NP_064090.2| atp8 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435112|ref|YP_004222331.1| ATPase subunit 8 [Beta vulgaris subsp. maritima] gi|346683204|ref|YP_004842137.1| ATPase subunit 8 [Beta macrocarpa] gi|148491438|dbj|BAA99483.2| ATPase subunit 8 [Beta vulgaris subsp. vulgaris] gi|317905666|emb|CBJ14062.1| ATPase subunit 8 [Beta vulgaris subsp. maritima] gi|319439845|emb|CBJ17553.1| ATPase subunit 8 [Beta vulgaris subsp. maritima] gi|320148092|emb|CBJ20754.1| ATPase subunit8 [Beta vulgaris subsp. maritima] gi|345500122|emb|CBX24941.1| ATPase subunit 8 [Beta macrocarpa] gi|384939132|emb|CBL51978.1| ATPase subunit 8 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 162 Score = 60.1 bits (144), Expect(2) = 4e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F LTFYI ICND DGVLGISRILKLRNQL+SH Sbjct: 19 FFLTFYILICNDRDGVLGISRILKLRNQLLSH 50 Score = 50.1 bits (118), Expect(2) = 4e-16 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFFL 207 MPQLD+FTYFTQFFWLCLFFL Sbjct: 1 MPQLDQFTYFTQFFWLCLFFL 21 >ref|YP_005090498.1| ATPase subunit 8 (mitochondrion) [Lotus japonicus] gi|357197362|gb|AET62958.1| ATPase subunit 8 (mitochondrion) [Lotus japonicus] Length = 160 Score = 60.1 bits (144), Expect(2) = 4e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYI ICNDGDGVLGISRILKLRNQLVS+ Sbjct: 19 FFFTFYILICNDGDGVLGISRILKLRNQLVSN 50 Score = 50.1 bits (118), Expect(2) = 4e-16 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYFTQFFWLCLFF Sbjct: 1 MPQLDKFTYFTQFFWLCLFF 20 >ref|YP_005090447.1| ATPase subunit 8 (mitochondrion) [Millettia pinnata] gi|357197310|gb|AET62907.1| ATPase subunit 8 (mitochondrion) [Millettia pinnata] Length = 160 Score = 60.1 bits (144), Expect(2) = 4e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYI ICNDGDGVLGISRILKLRNQLVS+ Sbjct: 19 FFFTFYILICNDGDGVLGISRILKLRNQLVSN 50 Score = 50.1 bits (118), Expect(2) = 4e-16 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYFTQFFWLCLFF Sbjct: 1 MPQLDKFTYFTQFFWLCLFF 20 >gb|AEN56101.1| ATPase subunit 8 [Cucumis melo subsp. melo] Length = 159 Score = 62.8 bits (151), Expect(2) = 5e-16 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F LTFYI ICNDGDGVLGISRILKLRNQLVSH Sbjct: 19 FFLTFYIPICNDGDGVLGISRILKLRNQLVSH 50 Score = 47.0 bits (110), Expect(2) = 5e-16 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFFL 207 MPQLDK TYFTQFFW CLFFL Sbjct: 1 MPQLDKLTYFTQFFWSCLFFL 21 >gb|AAB41357.1| unknown [Brassica napus] Length = 225 Score = 60.8 bits (146), Expect(2) = 6e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKL NQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLWNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 6e-16 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20 >pir||JQ1512 hypothetical 26.2K protein (atp6 5' region) - rape mitochondrion gi|167121|gb|AAA32982.1| Chimeric protein ORF224 (putative) [Brassica napus] gi|257560|gb|AAB23686.1| orf224 [Brassica napus] gi|88191704|gb|ABD42931.1| ORF224 [Brassica napus] gi|158828474|gb|ABW81222.1| cms male sterile-like protein [Brassica napus] gi|159507383|gb|ABW97712.1| cytoplasmic male sterility associated protein [Brassica napus] gi|339511282|emb|CBX48337.1| unnamed protein product [Brassica napus] Length = 224 Score = 60.8 bits (146), Expect(2) = 6e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 FLLTFYIFICNDGDGVLGISRILKLRNQLVSH 293 F TFYIFICNDGDGVLGISRILKL NQL+SH Sbjct: 19 FFFTFYIFICNDGDGVLGISRILKLWNQLLSH 50 Score = 48.5 bits (114), Expect(2) = 6e-16 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +1 Query: 145 MPQLDKFTYFTQFFWLCLFF 204 MPQLDKFTYF+QFFWLCLFF Sbjct: 1 MPQLDKFTYFSQFFWLCLFF 20