BLASTX nr result
ID: Jatropha_contig00023468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00023468 (293 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530843.1| conserved hypothetical protein [Ricinus comm... 80 3e-13 >ref|XP_002530843.1| conserved hypothetical protein [Ricinus communis] gi|223529607|gb|EEF31556.1| conserved hypothetical protein [Ricinus communis] Length = 589 Score = 80.1 bits (196), Expect = 3e-13 Identities = 48/87 (55%), Positives = 58/87 (66%), Gaps = 1/87 (1%) Frame = +2 Query: 35 PVLDQDNVDTKFVDSLERTQTSELRQCSDAEEPSSDIHCNKTDVEKASGKREACFDICLL 214 P LD VD + V+ RT EL+QC EEPSSDIH N + VE++ KREA +DICLL Sbjct: 477 PDLDHHYVDKELVNLSGRTW--ELKQCGGVEEPSSDIHSNNSQVERS--KREASYDICLL 532 Query: 215 DRSNVKKIRVTRESGES-DEDVLFPTD 292 DRS+VKK+R ES ES +D L PTD Sbjct: 533 DRSSVKKMREMVESYESGGKDALLPTD 559