BLASTX nr result
ID: Jatropha_contig00023211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00023211 (640 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529184.1| conserved hypothetical protein [Ricinus comm... 81 3e-13 >ref|XP_002529184.1| conserved hypothetical protein [Ricinus communis] gi|223531362|gb|EEF33198.1| conserved hypothetical protein [Ricinus communis] Length = 465 Score = 80.9 bits (198), Expect = 3e-13 Identities = 44/89 (49%), Positives = 53/89 (59%), Gaps = 1/89 (1%) Frame = +3 Query: 297 HRNRHTNDADGAFSVDTSSRRDGMSRGRWGNVH-PISPGSFPRRSNHRTTQVFEYRQKKL 473 HRN H DGAFS D+ R G++RG G+ H SP SF RRS +R T VFEYR KK Sbjct: 26 HRNPHITGGDGAFSDDSIYNRGGLARGGRGSAHYQSSPASFHRRSTYRPTPVFEYRVKKP 85 Query: 474 SEDGLSYSESLQQDQNAFNVSDSEPKPQQ 560 S D +E + QDQ+AFN S PK + Sbjct: 86 SRDESCQTEQVHQDQSAFNDIGSRPKQSE 114