BLASTX nr result
ID: Jatropha_contig00023016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00023016 (234 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR62557.1| hypothetical protein CICLE_v10016413mg [Citrus cl... 72 7e-11 gb|ESR62556.1| hypothetical protein CICLE_v10016413mg [Citrus cl... 72 7e-11 gb|EOY28287.1| RING/U-box superfamily protein [Theobroma cacao] 72 7e-11 ref|XP_004134714.1| PREDICTED: uncharacterized protein LOC101207... 72 7e-11 gb|AFK47500.1| unknown [Lotus japonicus] 72 7e-11 ref|XP_003542757.1| PREDICTED: uncharacterized protein LOC100786... 72 7e-11 ref|XP_003529317.1| PREDICTED: probable E3 ubiquitin-protein lig... 72 7e-11 ref|XP_002519042.1| protein binding protein, putative [Ricinus c... 72 7e-11 ref|XP_002269005.2| PREDICTED: uncharacterized protein LOC100244... 72 7e-11 ref|XP_002305807.1| predicted protein [Populus trichocarpa] gi|2... 71 2e-10 ref|XP_004505044.1| PREDICTED: uncharacterized protein LOC101502... 70 2e-10 ref|XP_006347060.1| PREDICTED: uncharacterized protein LOC102598... 70 3e-10 ref|XP_004232857.1| PREDICTED: uncharacterized protein LOC101244... 70 3e-10 ref|XP_004232856.1| PREDICTED: uncharacterized protein LOC101244... 70 3e-10 ref|XP_006361036.1| PREDICTED: uncharacterized protein LOC102584... 69 5e-10 gb|ESW31310.1| hypothetical protein PHAVU_002G227800g [Phaseolus... 69 5e-10 ref|XP_004485751.1| PREDICTED: uncharacterized protein LOC101513... 69 5e-10 ref|XP_004293584.1| PREDICTED: uncharacterized protein LOC101307... 69 5e-10 ref|XP_004248113.1| PREDICTED: uncharacterized protein LOC101248... 69 5e-10 gb|AFK44968.1| unknown [Medicago truncatula] 69 5e-10 >gb|ESR62557.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] Length = 206 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 9 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 54 >gb|ESR62556.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >gb|EOY28287.1| RING/U-box superfamily protein [Theobroma cacao] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >ref|XP_004134714.1| PREDICTED: uncharacterized protein LOC101207068 [Cucumis sativus] gi|449479335|ref|XP_004155572.1| PREDICTED: uncharacterized LOC101207068 [Cucumis sativus] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >gb|AFK47500.1| unknown [Lotus japonicus] Length = 192 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 51 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 96 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -2 Query: 155 PSAPARWQSVH*TRKRNRWAVCMERYRRRDDEEHWQHTEADIERED 18 PS + V T R + AVCMERYRRRDDEE+WQ ++ DIERED Sbjct: 105 PSLLQLQKGVTDTEDRKQKAVCMERYRRRDDEEYWQSSDLDIERED 150 >ref|XP_003542757.1| PREDICTED: uncharacterized protein LOC100786183 [Glycine max] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >ref|XP_003529317.1| PREDICTED: probable E3 ubiquitin-protein ligase makorin-1-like [Glycine max] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >ref|XP_002519042.1| protein binding protein, putative [Ricinus communis] gi|223541705|gb|EEF43253.1| protein binding protein, putative [Ricinus communis] Length = 247 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >ref|XP_002269005.2| PREDICTED: uncharacterized protein LOC100244841 [Vitis vinifera] gi|147854404|emb|CAN81290.1| hypothetical protein VITISV_005312 [Vitis vinifera] gi|296084737|emb|CBI25878.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 72.0 bits (175), Expect = 7e-11 Identities = 34/46 (73%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 45 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 90 >ref|XP_002305807.1| predicted protein [Populus trichocarpa] gi|222848771|gb|EEE86318.1| hypothetical protein POPTR_0004s04140g [Populus trichocarpa] Length = 247 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTM+THERKASI Sbjct: 50 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMTTHERKASI 95 >ref|XP_004505044.1| PREDICTED: uncharacterized protein LOC101502576 [Cicer arietinum] Length = 247 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLF VQWTDCH YKVYVDGTTTMSTHERKASI Sbjct: 50 AHLFLFFVQWTDCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI 95 >ref|XP_006347060.1| PREDICTED: uncharacterized protein LOC102598484 [Solanum tuberosum] Length = 253 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMS HERKASI Sbjct: 56 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSVHERKASI 101 >ref|XP_004232857.1| PREDICTED: uncharacterized protein LOC101244445 isoform 2 [Solanum lycopersicum] Length = 253 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMS HERKASI Sbjct: 56 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSVHERKASI 101 >ref|XP_004232856.1| PREDICTED: uncharacterized protein LOC101244445 isoform 1 [Solanum lycopersicum] Length = 262 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDCH YKVYVDGTTTMS HERKASI Sbjct: 56 AHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMSVHERKASI 101 >ref|XP_006361036.1| PREDICTED: uncharacterized protein LOC102584135 [Solanum tuberosum] Length = 252 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AH+FLFLVQWTDCH YKV+VDGTTTMSTHERKASI Sbjct: 54 AHIFLFLVQWTDCHLAGALGLLRILIYKVHVDGTTTMSTHERKASI 99 >gb|ESW31310.1| hypothetical protein PHAVU_002G227800g [Phaseolus vulgaris] Length = 375 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDC+ YKVYVDGTTTMSTHERKASI Sbjct: 178 AHLFLFLVQWTDCNLAGALGLLRILIYKVYVDGTTTMSTHERKASI 223 >ref|XP_004485751.1| PREDICTED: uncharacterized protein LOC101513299 [Cicer arietinum] Length = 251 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDC+ YKVYVDGTTTMSTHERKASI Sbjct: 54 AHLFLFLVQWTDCNLAGALGLLRILIYKVYVDGTTTMSTHERKASI 99 >ref|XP_004293584.1| PREDICTED: uncharacterized protein LOC101307179 [Fragaria vesca subsp. vesca] Length = 253 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDC+ YKVYVDGTTTMSTHERKASI Sbjct: 56 AHLFLFLVQWTDCNLAGALGLLRILIYKVYVDGTTTMSTHERKASI 101 >ref|XP_004248113.1| PREDICTED: uncharacterized protein LOC101248144 [Solanum lycopersicum] Length = 252 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AH+FLFLVQWTDCH YKV+VDGTTTMSTHERKASI Sbjct: 54 AHIFLFLVQWTDCHLAGALGLLRILIYKVHVDGTTTMSTHERKASI 99 >gb|AFK44968.1| unknown [Medicago truncatula] Length = 230 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 97 AHLFLFLVQWTDCHXXXXXXXXXXXXYKVYVDGTTTMSTHERKASI 234 AHLFLFLVQWTDC+ YKVYVDGTTTMSTHERKASI Sbjct: 54 AHLFLFLVQWTDCNLAGALGLLRILIYKVYVDGTTTMSTHERKASI 99