BLASTX nr result
ID: Jatropha_contig00022892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00022892 (526 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 102 5e-20 gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] 59 6e-07 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 102 bits (254), Expect = 5e-20 Identities = 63/105 (60%), Positives = 69/105 (65%), Gaps = 8/105 (7%) Frame = +2 Query: 11 FESNKVSSRGFIATFILKETEKPTFSQ*EPYLPLC---DLITSANQFLS*SPGGAHLWYF 181 FESNKVSSRGFIATF+LKE+E+PTFSQ LP L SAN FLS WYF Sbjct: 54 FESNKVSSRGFIATFVLKESEEPTFSQIRALLPSLRPHHLNLSANPFLSHRAERTFGWYF 113 Query: 182 SRASSLIVASF-----GATNTSMTERAGNSKGSPLEAFAGNQSVT 301 SRA LI ASF TS+ + AGN +GSPLEAFAGNQSVT Sbjct: 114 SRAGCLIAASFFRLVGRRKATSIYKTAGNLRGSPLEAFAGNQSVT 158 >gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 120 Score = 58.9 bits (141), Expect = 6e-07 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +1 Query: 331 LNPIHKPGNETKFVPFRQVGKVGI*T--TFALP*ILLEQSKERGG 459 +NPIHKPGNETKFVPFRQVGKVGI T FAL I +Q + R G Sbjct: 1 MNPIHKPGNETKFVPFRQVGKVGIRTHFCFALDYIGTKQRRRRNG 45