BLASTX nr result
ID: Jatropha_contig00022411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00022411 (747 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534746.1| conserved hypothetical protein [Ricinus comm... 75 2e-11 >ref|XP_002534746.1| conserved hypothetical protein [Ricinus communis] gi|255603999|ref|XP_002538151.1| conserved hypothetical protein [Ricinus communis] gi|223513574|gb|EEF24231.1| conserved hypothetical protein [Ricinus communis] gi|223524643|gb|EEF27637.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/55 (76%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 744 MGSWGSVVGEGR-FED**RQKPDHPELSSRVCRLKEEGRQLKCQRKNRKSRAVQS 583 MGSWGSVVGEGR + PELSSRV RLKEEGRQLKCQRKNRKSRAVQS Sbjct: 1 MGSWGSVVGEGRGCRRLIEAEAGPPELSSRVGRLKEEGRQLKCQRKNRKSRAVQS 55