BLASTX nr result
ID: Jatropha_contig00022225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00022225 (147 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002969814.1| hypothetical protein SELMODRAFT_231460 [Sela... 64 3e-08 ref|XP_001769672.1| predicted protein [Physcomitrella patens] gi... 64 3e-08 ref|XP_001777020.1| predicted protein [Physcomitrella patens] gi... 64 3e-08 ref|XP_006359523.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 gb|ESW27103.1| hypothetical protein PHAVU_003G174100g [Phaseolus... 62 6e-08 gb|ESR66955.1| hypothetical protein CICLE_v10007342mg [Citrus cl... 62 6e-08 gb|EEE92835.2| elongation factor Tu family protein [Populus tric... 62 6e-08 gb|EOY33420.1| Ribosomal protein S5/Elongation factor G/III/V fa... 62 6e-08 gb|EMT00518.1| 116 kDa U5 small nuclear ribonucleoprotein compon... 62 6e-08 gb|EMJ18344.1| hypothetical protein PRUPE_ppa000830mg [Prunus pe... 62 6e-08 ref|XP_004242711.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 ref|XP_004139267.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 ref|NP_001058038.1| Os06g0608300 [Oryza sativa Japonica Group] g... 62 6e-08 ref|XP_003563643.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 ref|XP_003549705.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 ref|XP_003542669.1| PREDICTED: 116 kDa U5 small nuclear ribonucl... 62 6e-08 dbj|BAJ96337.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 6e-08 emb|CBI25589.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002438662.1| hypothetical protein SORBIDRAFT_10g023820 [S... 62 6e-08 gb|ACN85310.1| U5 small nuclear ribonucleoprotein component [Ory... 62 6e-08 >ref|XP_002969814.1| hypothetical protein SELMODRAFT_231460 [Selaginella moellendorffii] gi|302806838|ref|XP_002985150.1| hypothetical protein SELMODRAFT_268956 [Selaginella moellendorffii] gi|300146978|gb|EFJ13644.1| hypothetical protein SELMODRAFT_268956 [Selaginella moellendorffii] gi|300162325|gb|EFJ28938.1| hypothetical protein SELMODRAFT_231460 [Selaginella moellendorffii] Length = 982 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 AP+QHLAREFMV TRRRKGMSEDVSINKFF+D Sbjct: 934 APVQHLAREFMVKTRRRKGMSEDVSINKFFDD 965 >ref|XP_001769672.1| predicted protein [Physcomitrella patens] gi|162679021|gb|EDQ65473.1| predicted protein [Physcomitrella patens] Length = 982 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 AP+QHLAREFMV TRRRKGMSEDVSINKFF+D Sbjct: 934 APVQHLAREFMVKTRRRKGMSEDVSINKFFDD 965 >ref|XP_001777020.1| predicted protein [Physcomitrella patens] gi|162671585|gb|EDQ58134.1| predicted protein [Physcomitrella patens] Length = 982 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 AP+QHLAREFMV TRRRKGMSEDVSINKFF+D Sbjct: 934 APVQHLAREFMVKTRRRKGMSEDVSINKFFDD 965 >ref|XP_006359523.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform X1 [Solanum tuberosum] gi|565387474|ref|XP_006359524.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform X2 [Solanum tuberosum] Length = 987 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 938 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 969 >gb|ESW27103.1| hypothetical protein PHAVU_003G174100g [Phaseolus vulgaris] Length = 986 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 937 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 968 >gb|ESR66955.1| hypothetical protein CICLE_v10007342mg [Citrus clementina] Length = 989 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 940 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 971 >gb|EEE92835.2| elongation factor Tu family protein [Populus trichocarpa] Length = 969 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 921 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 952 >gb|EOY33420.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Theobroma cacao] Length = 990 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 941 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 972 >gb|EMT00518.1| 116 kDa U5 small nuclear ribonucleoprotein component [Aegilops tauschii] Length = 942 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 894 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 925 >gb|EMJ18344.1| hypothetical protein PRUPE_ppa000830mg [Prunus persica] Length = 988 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 939 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 970 >ref|XP_004242711.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Solanum lycopersicum] Length = 987 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 938 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 969 >ref|XP_004139267.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Cucumis sativus] gi|449493675|ref|XP_004159406.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Cucumis sativus] Length = 988 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 939 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 970 >ref|NP_001058038.1| Os06g0608300 [Oryza sativa Japonica Group] gi|51090357|dbj|BAD35618.1| putative elongation factor 2 [Oryza sativa Japonica Group] gi|113596078|dbj|BAF19952.1| Os06g0608300 [Oryza sativa Japonica Group] gi|215736847|dbj|BAG95776.1| unnamed protein product [Oryza sativa Japonica Group] gi|225216861|gb|ACN85159.1| U5 small nuclear ribonucleoprotein component [Oryza nivara] Length = 997 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 948 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 979 >ref|XP_003563643.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Brachypodium distachyon] Length = 995 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 946 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 977 >ref|XP_003549705.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Glycine max] Length = 988 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 939 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 970 >ref|XP_003542669.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Glycine max] Length = 986 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 937 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 968 >dbj|BAJ96337.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 452 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 404 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 435 >emb|CBI25589.3| unnamed protein product [Vitis vinifera] Length = 931 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 882 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 913 >ref|XP_002438662.1| hypothetical protein SORBIDRAFT_10g023820 [Sorghum bicolor] gi|241916885|gb|EER90029.1| hypothetical protein SORBIDRAFT_10g023820 [Sorghum bicolor] Length = 995 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 946 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 977 >gb|ACN85310.1| U5 small nuclear ribonucleoprotein component [Oryza brachyantha] Length = 994 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 113 APIQHLAREFMVTTRRRKGMSEDVSINKFFED 18 APIQHLAREFMV TRRRKGMSEDVSINKFF++ Sbjct: 945 APIQHLAREFMVKTRRRKGMSEDVSINKFFDE 976