BLASTX nr result
ID: Jatropha_contig00022186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00022186 (199 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 77 2e-12 gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 75 6e-12 gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] 75 6e-12 gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus... 74 2e-11 ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplas... 73 3e-11 gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] 73 3e-11 dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] 73 3e-11 gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arbor... 73 4e-11 gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] 73 4e-11 ref|XP_006366441.1| PREDICTED: allene oxide synthase, chloroplas... 72 5e-11 gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] 72 5e-11 emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] 72 5e-11 ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum]... 72 5e-11 ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplas... 72 9e-11 gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796... 72 9e-11 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 +DEAEKMGIS+DEACHN+LFATCFNTFGGMKIFFPN Sbjct: 300 LDEAEKMGISRDEACHNLLFATCFNTFGGMKIFFPN 335 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 101 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEE 199 LIHTFRLPAFLIKKDY++LYDYF SSAGS+L+E Sbjct: 270 LIHTFRLPAFLIKKDYKRLYDYFNSSAGSLLDE 302 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 75.5 bits (184), Expect = 6e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 +DEAEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 304 LDEAEKMGISREEACHNILFATCFNTFGGLKIFFPN 339 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +2 Query: 104 IHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEE 199 IHTFRLPAFL+KKDY++LYDYFYSSAGS+L+E Sbjct: 275 IHTFRLPAFLVKKDYKRLYDYFYSSAGSLLDE 306 >gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] Length = 457 Score = 75.5 bits (184), Expect = 6e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 +DEAEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 237 LDEAEKMGISREEACHNILFATCFNTFGGLKIFFPN 272 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +2 Query: 104 IHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEE 199 IHTFRLPAFL+KKDY++LYDYFYSSAGS+L+E Sbjct: 208 IHTFRLPAFLVKKDYKRLYDYFYSSAGSLLDE 239 >gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] Length = 518 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 127 SRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 S T +DEAE++GI++DEACHN+LFATCFN+FGGMK+FFPN Sbjct: 291 SSSTSVLDEAERLGITRDEACHNLLFATCFNSFGGMKLFFPN 332 >ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum lycopersicum] gi|7677376|gb|AAF67141.1| allene oxide synthase [Solanum lycopersicum] Length = 510 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISKDEACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKDEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] Length = 376 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 127 SRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 + TE +DEAE +G+S++EACHN+LFATCFN+FGGMKIFFPN Sbjct: 149 ANSTEILDEAENLGLSREEACHNLLFATCFNSFGGMKIFFPN 190 >dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] Length = 519 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 127 SRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 + TE +DEAE +G+S++EACHN+LFATCFN+FGGMKIFFPN Sbjct: 292 ANSTEILDEAENLGLSREEACHNLLFATCFNSFGGMKIFFPN 333 >gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arboreum] Length = 418 Score = 72.8 bits (177), Expect = 4e-11 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 106 DEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 DEAEK+GIS++E CHN+LFATCFNTFGGMKIFFPN Sbjct: 198 DEAEKLGISREEVCHNLLFATCFNTFGGMKIFFPN 232 >gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] Length = 494 Score = 72.8 bits (177), Expect = 4e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 ++EAEK+GIS+DEACHN+LFATCFN+FGGMKIFFPN Sbjct: 278 LNEAEKLGISRDEACHNLLFATCFNSFGGMKIFFPN 313 >ref|XP_006366441.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum tuberosum] Length = 530 Score = 72.4 bits (176), Expect = 5e-11 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -1 Query: 157 QFLVVFLDEKSRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 Q L F E S T +DEAEK+GIS++EACHN+LFATCFN+FGG+KIFFPN Sbjct: 295 QRLYNFFYENS--TSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFPN 344 >gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 72.4 bits (176), Expect = 5e-11 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 +DEAE+MG++++EACHNILFATCFNTFGG+KIFFPN Sbjct: 304 LDEAERMGLTREEACHNILFATCFNTFGGLKIFFPN 339 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 104 IHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEE 199 IHTFRLPAF+IKKDYQ+LYDYFYSS GSVL+E Sbjct: 275 IHTFRLPAFIIKKDYQRLYDYFYSSGGSVLDE 306 >emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] Length = 530 Score = 72.4 bits (176), Expect = 5e-11 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -1 Query: 157 QFLVVFLDEKSRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 Q L F E S T +DEAEK+GIS++EACHN+LFATCFN+FGG+KIFFPN Sbjct: 295 QRLYNFFYENS--TSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFPN 344 >ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum] gi|7581989|emb|CAB88032.1| allene oxide synthase [Solanum lycopersicum] Length = 534 Score = 72.4 bits (176), Expect = 5e-11 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -1 Query: 157 QFLVVFLDEKSRKTEGVDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 Q L F E S T +DEAEK+GIS++EACHN+LFATCFN+FGG+KIFFPN Sbjct: 299 QRLYNFFYENS--TSVLDEAEKIGISREEACHNLLFATCFNSFGGIKIFFPN 348 >ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplastic [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 103 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796032|gb|ABB91777.1| allene oxide synthase [Glycine max] gi|169786998|gb|ACA79943.1| chloroplast allene oxide synthase [Glycine max] Length = 519 Score = 71.6 bits (174), Expect = 9e-11 Identities = 28/36 (77%), Positives = 36/36 (100%) Frame = -1 Query: 109 VDEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 2 +DEAE++GI++DEACHN+LFATCFN+FGGMK+FFPN Sbjct: 298 LDEAERLGITRDEACHNLLFATCFNSFGGMKLFFPN 333