BLASTX nr result
ID: Jatropha_contig00021841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021841 (200 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 64 2e-08 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +2 Query: 11 KLGEEGISIAKDSDSIQPQVPLRLPCYDFTPVEDP 115 KLGEE ISIAKDS IQPQVPLRLPCYDFTPVEDP Sbjct: 39 KLGEECISIAKDS--IQPQVPLRLPCYDFTPVEDP 71