BLASTX nr result
ID: Jatropha_contig00021515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021515 (563 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520450.1| hypothetical protein RCOM_0731250 [Ricinus c... 79 1e-12 gb|ERP56830.1| hypothetical protein POPTR_0009s04520g [Populus t... 58 2e-06 >ref|XP_002520450.1| hypothetical protein RCOM_0731250 [Ricinus communis] gi|223540292|gb|EEF41863.1| hypothetical protein RCOM_0731250 [Ricinus communis] Length = 1329 Score = 78.6 bits (192), Expect = 1e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 218 GLQQTHSQHPVQSLAQHLTSQPNQPVNPHLQPQLQHSSANAVTGHHSY 75 GL QTH+Q+P+Q + Q SQPN PVNPH+QPQ QHSSA+AVTGHHSY Sbjct: 387 GLPQTHAQYPMQPIPQPFASQPNHPVNPHVQPQPQHSSAHAVTGHHSY 434 >gb|ERP56830.1| hypothetical protein POPTR_0009s04520g [Populus trichocarpa] Length = 1315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 188 VQSLAQHLTSQPNQPVNPHLQPQLQHSSANAVTGHHSY 75 +Q L Q L SQP+Q VNP+LQ Q QHSS NAVTGHHSY Sbjct: 383 LQPLPQSLASQPSQTVNPNLQTQPQHSSVNAVTGHHSY 420