BLASTX nr result
ID: Jatropha_contig00021512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021512 (266 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158911.1| PREDICTED: guanine nucleotide-binding protei... 98 1e-18 ref|XP_004146974.1| PREDICTED: guanine nucleotide-binding protei... 98 1e-18 gb|EEE82305.2| hypothetical protein POPTR_0002s24220g [Populus t... 97 2e-18 ref|XP_002303032.1| predicted protein [Populus trichocarpa] 97 2e-18 ref|XP_002521110.1| GTP-binding protein-plant, putative [Ricinus... 95 1e-17 gb|EMJ01961.1| hypothetical protein PRUPE_ppa023482mg [Prunus pe... 93 4e-17 ref|XP_004155226.1| PREDICTED: guanine nucleotide-binding protei... 92 7e-17 ref|XP_004133732.1| PREDICTED: guanine nucleotide-binding protei... 92 7e-17 ref|XP_004291808.1| PREDICTED: guanine nucleotide-binding protei... 89 4e-16 gb|EOX93957.1| GTP-binding family protein [Theobroma cacao] 89 7e-16 ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protei... 88 1e-15 gb|ESR56866.1| hypothetical protein CICLE_v10019400mg [Citrus cl... 87 2e-15 gb|ESQ37124.1| hypothetical protein EUTSA_v10002456mg [Eutrema s... 86 4e-15 gb|ESQ49329.1| hypothetical protein EUTSA_v10020356mg [Eutrema s... 86 5e-15 ref|XP_002267566.1| PREDICTED: guanine nucleotide-binding protei... 84 1e-14 emb|CAN64618.1| hypothetical protein VITISV_001358 [Vitis vinifera] 84 1e-14 ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protei... 84 2e-14 ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] g... 84 2e-14 ref|XP_006297312.1| hypothetical protein CARUB_v10013329mg [Caps... 83 3e-14 ref|XP_002884623.1| GTP-binding family protein [Arabidopsis lyra... 83 3e-14 >ref|XP_004158911.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Cucumis sativus] Length = 584 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPPIR++ EPSEARIV+ELGK+FN+DEVY GESSFIGSLKSVND+NPV Sbjct: 408 IPYYTMPPIRSQVEPSEARIVTELGKDFNIDEVYGGESSFIGSLKSVNDFNPV 460 >ref|XP_004146974.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Cucumis sativus] Length = 578 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPPIR++ EPSEARIV+ELGK+FN+DEVY GESSFIGSLKSVND+NPV Sbjct: 408 IPYYTMPPIRSQVEPSEARIVTELGKDFNIDEVYGGESSFIGSLKSVNDFNPV 460 >gb|EEE82305.2| hypothetical protein POPTR_0002s24220g [Populus trichocarpa] Length = 600 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP RN+ EPSEA+IVSELGKEFN+DEVY+GESSFIGSLKS +DYNPV Sbjct: 409 IPYYTMPPARNQGEPSEAKIVSELGKEFNIDEVYNGESSFIGSLKSADDYNPV 461 >ref|XP_002303032.1| predicted protein [Populus trichocarpa] Length = 191 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP RN+ EPSEA+IVSELGKEFN+DEVY+GESSFIGSLKS +DYNPV Sbjct: 110 IPYYTMPPARNQGEPSEAKIVSELGKEFNIDEVYNGESSFIGSLKSADDYNPV 162 >ref|XP_002521110.1| GTP-binding protein-plant, putative [Ricinus communis] gi|223539679|gb|EEF41261.1| GTP-binding protein-plant, putative [Ricinus communis] Length = 599 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/53 (79%), Positives = 51/53 (96%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 + YYTMPP RN+EEPSE++IVSELGKEFN+DEVY+GE+SFIGSLKSVND++PV Sbjct: 405 IAYYTMPPTRNQEEPSESKIVSELGKEFNIDEVYTGETSFIGSLKSVNDFDPV 457 >gb|EMJ01961.1| hypothetical protein PRUPE_ppa023482mg [Prunus persica] Length = 567 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/53 (77%), Positives = 50/53 (94%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP+RN+EEPSEA IVS+LGK FN+DEVY+ ESSFIGSLKSV+D++PV Sbjct: 405 IPYYTMPPVRNQEEPSEANIVSQLGKVFNIDEVYNAESSFIGSLKSVSDFHPV 457 >ref|XP_004155226.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Cucumis sativus] Length = 574 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP+RN +EPSEARIVSELGKEF++D VYSGESSFIGSLKS +D+NPV Sbjct: 408 IPYYTMPPVRN-QEPSEARIVSELGKEFDIDAVYSGESSFIGSLKSADDFNPV 459 >ref|XP_004133732.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Cucumis sativus] Length = 574 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP+RN +EPSEARIVSELGKEF++D VYSGESSFIGSLKS +D+NPV Sbjct: 408 IPYYTMPPVRN-QEPSEARIVSELGKEFDIDAVYSGESSFIGSLKSADDFNPV 459 >ref|XP_004291808.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Fragaria vesca subsp. vesca] Length = 605 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYT+PP R++EEPS A+IVSELGK N+DEVY+GESSFIGSLKSVND++PV Sbjct: 405 IPYYTVPPARSQEEPSVAKIVSELGKALNIDEVYNGESSFIGSLKSVNDFHPV 457 >gb|EOX93957.1| GTP-binding family protein [Theobroma cacao] Length = 586 Score = 88.6 bits (218), Expect = 7e-16 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP+RN+ EPSEARI +ELGKEFNVDEVY+ ESSFIGSLKS +D++ + Sbjct: 404 IPYYTMPPVRNQGEPSEARIATELGKEFNVDEVYTSESSFIGSLKSADDFHSI 456 >ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Solanum tuberosum] Length = 608 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYT+PP RN E SE +IVSELGKEFN+DEVY ESS IGSLKSVND+NPV Sbjct: 416 IPYYTLPPTRNEGEHSEVKIVSELGKEFNIDEVYGSESSIIGSLKSVNDFNPV 468 >gb|ESR56866.1| hypothetical protein CICLE_v10019400mg [Citrus clementina] Length = 596 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP R++ PSEARIVSELGKEFNV+EVY ESSFIGSLKSV+D+ PV Sbjct: 409 IPYYTMPPARDQGIPSEARIVSELGKEFNVNEVYKNESSFIGSLKSVDDFQPV 461 >gb|ESQ37124.1| hypothetical protein EUTSA_v10002456mg [Eutrema salsugineum] Length = 591 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/53 (71%), Positives = 49/53 (92%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP R++ E +E++IV+EL KEFN+DEVYSGESSFIGSLK++ND+NPV Sbjct: 406 IPYYTMPPKRDQGEHAESKIVTELAKEFNIDEVYSGESSFIGSLKTLNDFNPV 458 >gb|ESQ49329.1| hypothetical protein EUTSA_v10020356mg [Eutrema salsugineum] Length = 591 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PY+TMPP R++ E E++IV+EL KEFN+DEVYSGESSFIGSLKSVND+NPV Sbjct: 407 IPYFTMPPKRDQGEHVESKIVTELAKEFNIDEVYSGESSFIGSLKSVNDFNPV 459 >ref|XP_002267566.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Vitis vinifera] gi|297744311|emb|CBI37281.3| unnamed protein product [Vitis vinifera] Length = 596 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP RN+ E EA IVSE GKEFN+DEVY+ ESSFIGSLKSV+D++PV Sbjct: 414 IPYYTMPPSRNQGENLEATIVSEFGKEFNIDEVYNSESSFIGSLKSVDDFHPV 466 >emb|CAN64618.1| hypothetical protein VITISV_001358 [Vitis vinifera] Length = 593 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP RN+ E EA IVSE GKEFN+DEVY+ ESSFIGSLKSV+D++PV Sbjct: 409 IPYYTMPPSRNQGENLEATIVSEFGKEFNIDEVYNSESSFIGSLKSVDDFHPV 461 >ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Solanum lycopersicum] Length = 605 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP RN E SE +IVSELGKEFNVDEVY ESS IGSLKSV+D+ PV Sbjct: 412 IPYYTMPPSRNEGEHSEVKIVSELGKEFNVDEVYGSESSIIGSLKSVDDFLPV 464 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gi|83630757|gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYT+PP RN E E +IVSE GKEFN+DEVY ESS IGSLKSVND+NPV Sbjct: 417 VPYYTLPPTRNEGEHLEVKIVSEFGKEFNIDEVYGSESSIIGSLKSVNDFNPV 469 >ref|XP_006297312.1| hypothetical protein CARUB_v10013329mg [Capsella rubella] gi|482566021|gb|EOA30210.1| hypothetical protein CARUB_v10013329mg [Capsella rubella] Length = 574 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/53 (69%), Positives = 48/53 (90%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP R++ +E++IV+EL KEFN+DEVYSGESSFIGSLK+VN++NPV Sbjct: 400 IPYYTMPPKRDQGGHAESKIVTELAKEFNIDEVYSGESSFIGSLKTVNEFNPV 452 >ref|XP_002884623.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297330463|gb|EFH60882.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/53 (69%), Positives = 48/53 (90%) Frame = +2 Query: 107 LPYYTMPPIRNREEPSEARIVSELGKEFNVDEVYSGESSFIGSLKSVNDYNPV 265 +PYYTMPP R++ +E++IVSEL K+FN+DEVYSGESSFIGSLK+VN++NPV Sbjct: 400 IPYYTMPPKRDQGGHAESKIVSELAKDFNIDEVYSGESSFIGSLKTVNEFNPV 452