BLASTX nr result
ID: Jatropha_contig00021483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021483 (210 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511578.1| RNA binding protein, putative [Ricinus commu... 55 7e-06 >ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis] gi|223548758|gb|EEF50247.1| RNA binding protein, putative [Ricinus communis] Length = 295 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +1 Query: 31 MNPFDLLGYDDAEDPLPLVAVQQHKVAAISAAAPKKVQSHAHTKQVVQSLSLAK--LPAK 204 MNPFDLLG DDAEDP L+A +AA PKK QS KQ QSL AK PAK Sbjct: 4 MNPFDLLGDDDAEDPSQLIAA--------AAAVPKKAQSQPLAKQQPQSLPQAKQQQPAK 55 Query: 205 LP 210 LP Sbjct: 56 LP 57