BLASTX nr result
ID: Jatropha_contig00021381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021381 (519 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520026.1| pentatricopeptide repeat-containing protein,... 61 7e-12 gb|EEE99762.2| hypothetical protein POPTR_0019s07590g [Populus t... 62 2e-10 ref|XP_002325381.1| predicted protein [Populus trichocarpa] 62 2e-10 gb|ERP49041.1| hypothetical protein POPTR_0019s07590g [Populus t... 62 2e-10 ref|XP_004966595.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004964335.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004504387.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 gb|AFW86149.1| hypothetical protein ZEAMMB73_846563 [Zea mays] 61 2e-07 ref|XP_002436360.1| hypothetical protein SORBIDRAFT_10g001070 [S... 61 2e-07 ref|NP_001169631.1| uncharacterized protein LOC100383512 [Zea ma... 61 2e-07 ref|XP_006347572.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_004235284.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003532731.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 gb|ERN15559.1| hypothetical protein AMTR_s00048p00132600 [Ambore... 59 5e-07 emb|CBI26526.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002274101.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 gb|ESR56456.1| hypothetical protein CICLE_v10018634mg [Citrus cl... 58 7e-07 gb|ESR56458.1| hypothetical protein CICLE_v10018634mg [Citrus cl... 58 7e-07 gb|EOY10066.1| Tetratricopeptide repeat-like superfamily protein... 58 1e-06 gb|EMT15101.1| hypothetical protein F775_18738 [Aegilops tauschii] 58 1e-06 >ref|XP_002520026.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540790|gb|EEF42350.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1040 Score = 61.2 bits (147), Expect(2) = 7e-12 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWREARDFF WMKLQ+ Y P Sbjct: 151 KLSFREMCVVLKEQKGWREARDFFYWMKLQICYHP 185 Score = 34.3 bits (77), Expect(2) = 7e-12 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 516 KREEERNVRLLMSGL*GSNFSRDVC 442 KREEERNVRL+MSG G R++C Sbjct: 134 KREEERNVRLVMSGFVGKLSFREMC 158 >gb|EEE99762.2| hypothetical protein POPTR_0019s07590g [Populus trichocarpa] Length = 1073 Score = 61.6 bits (148), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWREARDFF+WMKLQ+ Y P Sbjct: 151 KLSFREMCVVLKEQKGWREARDFFSWMKLQLSYHP 185 Score = 29.3 bits (64), Expect(2) = 2e-10 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 516 KREEERNVRLLMSGL*GSNFSRDVC 442 K+ EER++RLLMSG G R++C Sbjct: 134 KKNEERDMRLLMSGFVGKLSFREMC 158 >ref|XP_002325381.1| predicted protein [Populus trichocarpa] Length = 1071 Score = 61.6 bits (148), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWREARDFF+WMKLQ+ Y P Sbjct: 151 KLSFREMCVVLKEQKGWREARDFFSWMKLQLSYHP 185 Score = 29.3 bits (64), Expect(2) = 2e-10 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 516 KREEERNVRLLMSGL*GSNFSRDVC 442 K+ EER++RLLMSG G R++C Sbjct: 134 KKNEERDMRLLMSGFVGKLSFREMC 158 >gb|ERP49041.1| hypothetical protein POPTR_0019s07590g [Populus trichocarpa] Length = 907 Score = 61.6 bits (148), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWREARDFF+WMKLQ+ Y P Sbjct: 151 KLSFREMCVVLKEQKGWREARDFFSWMKLQLSYHP 185 Score = 29.3 bits (64), Expect(2) = 2e-10 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 516 KREEERNVRLLMSGL*GSNFSRDVC 442 K+ EER++RLLMSG G R++C Sbjct: 134 KKNEERDMRLLMSGFVGKLSFREMC 158 >ref|XP_004966595.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Setaria italica] Length = 115 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQVYSPILN 357 ++TF+EMCVVL+EQ+GWR+ARDFFAWMKLQV P L+ Sbjct: 64 KLTFREMCVVLREQRGWRQARDFFAWMKLQVCKPGLS 100 >ref|XP_004964335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Setaria italica] Length = 1021 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 ++TF+EMCVVL+EQ+GWR+ARDFFAWMKLQ+ Y P Sbjct: 122 KLTFREMCVVLREQRGWRQARDFFAWMKLQLCYEP 156 >ref|XP_004504387.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like isoform X1 [Cicer arietinum] gi|502140956|ref|XP_004504388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like isoform X2 [Cicer arietinum] Length = 1072 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 ++TF+EMC+VLKEQKGWR+ RDFFAWMKLQ+ Y P Sbjct: 154 KLTFKEMCIVLKEQKGWRQVRDFFAWMKLQLSYHP 188 >gb|AFW86149.1| hypothetical protein ZEAMMB73_846563 [Zea mays] Length = 1039 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -2 Query: 464 VTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +TF+EMCVVL+EQ+GWR+ARDFFAWMKLQ+ Y P Sbjct: 138 LTFREMCVVLREQRGWRQARDFFAWMKLQLCYEP 171 >ref|XP_002436360.1| hypothetical protein SORBIDRAFT_10g001070 [Sorghum bicolor] gi|241914583|gb|EER87727.1| hypothetical protein SORBIDRAFT_10g001070 [Sorghum bicolor] Length = 999 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -2 Query: 464 VTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +TF+EMCVVL+EQ+GWR+ARDFFAWMKLQ+ Y P Sbjct: 139 LTFREMCVVLREQRGWRQARDFFAWMKLQLCYEP 172 >ref|NP_001169631.1| uncharacterized protein LOC100383512 [Zea mays] gi|224030539|gb|ACN34345.1| unknown [Zea mays] gi|413953501|gb|AFW86150.1| hypothetical protein ZEAMMB73_846563 [Zea mays] Length = 790 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -2 Query: 464 VTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +TF+EMCVVL+EQ+GWR+ARDFFAWMKLQ+ Y P Sbjct: 138 LTFREMCVVLREQRGWRQARDFFAWMKLQLCYEP 171 >ref|XP_006347572.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Solanum tuberosum] Length = 1065 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 ++TF+EMCVVLKEQ+GWR+ RDFFAWMKLQ+ Y P Sbjct: 152 KLTFREMCVVLKEQRGWRQVRDFFAWMKLQLSYRP 186 >ref|XP_004235284.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Solanum lycopersicum] Length = 1013 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 ++TF+EMCVVLKEQ+GWR+ RDFFAWMKLQ+ Y P Sbjct: 152 KLTFREMCVVLKEQRGWRQVRDFFAWMKLQLSYRP 186 >ref|XP_003532731.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Glycine max] Length = 1079 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWR+ RDFFAWMKLQ+ Y P Sbjct: 160 KLSFKEMCVVLKEQKGWRQVRDFFAWMKLQLSYRP 194 >gb|ERN15559.1| hypothetical protein AMTR_s00048p00132600 [Amborella trichopoda] Length = 1053 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -2 Query: 464 VTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 + F+EMC+VLKEQKGWR+ARDFF+WMKLQ+ Y P Sbjct: 140 LNFREMCIVLKEQKGWRQARDFFSWMKLQLSYRP 173 >emb|CBI26526.3| unnamed protein product [Vitis vinifera] Length = 1005 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQ+GWR+ARDFF WMKLQ+ Y P Sbjct: 156 KLSFREMCVVLKEQRGWRQARDFFGWMKLQLSYQP 190 >ref|XP_002274101.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270-like [Vitis vinifera] Length = 1071 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQ+GWR+ARDFF WMKLQ+ Y P Sbjct: 156 KLSFREMCVVLKEQRGWRQARDFFGWMKLQLSYQP 190 >gb|ESR56456.1| hypothetical protein CICLE_v10018634mg [Citrus clementina] Length = 1063 Score = 57.8 bits (138), Expect(2) = 7e-07 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWR+A +FFAWMKLQ+ Y P Sbjct: 149 KLSFREMCVVLKEQKGWRQATEFFAWMKLQLSYRP 183 Score = 20.8 bits (42), Expect(2) = 7e-07 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 519 RKREEERNVRLLMSGL*GSNFSRDVC 442 R + RNVR++M G R++C Sbjct: 131 RAMDGSRNVRVVMGSFVGKLSFREMC 156 >gb|ESR56458.1| hypothetical protein CICLE_v10018634mg [Citrus clementina] Length = 865 Score = 57.8 bits (138), Expect(2) = 7e-07 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 +++F+EMCVVLKEQKGWR+A +FFAWMKLQ+ Y P Sbjct: 149 KLSFREMCVVLKEQKGWRQATEFFAWMKLQLSYRP 183 Score = 20.8 bits (42), Expect(2) = 7e-07 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 519 RKREEERNVRLLMSGL*GSNFSRDVC 442 R + RNVR++M G R++C Sbjct: 131 RAMDGSRNVRVVMGSFVGKLSFREMC 156 >gb|EOY10066.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 1085 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV 375 +++F+EMCVVLKEQK WR+ RDFFAWMKLQ+ Sbjct: 150 KLSFREMCVVLKEQKNWRQVRDFFAWMKLQI 180 >gb|EMT15101.1| hypothetical protein F775_18738 [Aegilops tauschii] Length = 892 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 467 EVTFQEMCVVLKEQKGWREARDFFAWMKLQV-YSP 366 ++TF+EMCVVL+EQ+GWR+A DFF+WMKLQ+ Y P Sbjct: 7 KLTFREMCVVLREQRGWRQAHDFFSWMKLQLCYEP 41