BLASTX nr result
ID: Jatropha_contig00021318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021318 (191 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 75 7e-12 gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 74 2e-11 gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] 74 2e-11 ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplas... 73 3e-11 gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arbor... 73 4e-11 ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|4... 72 7e-11 gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] 72 7e-11 gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] 72 7e-11 ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplas... 72 9e-11 gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] 72 9e-11 emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] 72 9e-11 gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] 72 9e-11 gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] 70 2e-10 gb|AGV22361.1| chloroplast allene oxide synthase 6 [Gossypium ar... 70 3e-10 gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus... 70 4e-10 ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796... 70 4e-10 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAEKMGIS+DEACHN+LFATCFNTFGGMKIFFPN Sbjct: 301 DEAEKMGISRDEACHNLLFATCFNTFGGMKIFFPN 335 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGS 189 LIHTFRLPAFLIKKDY++LYDYF SSAGS Sbjct: 270 LIHTFRLPAFLIKKDYKRLYDYFNSSAGS 298 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 305 DEAEKMGISREEACHNILFATCFNTFGGLKIFFPN 339 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 106 IHTFRLPAFLIKKDYQKLYDYFYSSAGS 189 IHTFRLPAFL+KKDY++LYDYFYSSAGS Sbjct: 275 IHTFRLPAFLVKKDYKRLYDYFYSSAGS 302 >gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] Length = 457 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 238 DEAEKMGISREEACHNILFATCFNTFGGLKIFFPN 272 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 106 IHTFRLPAFLIKKDYQKLYDYFYSSAGS 189 IHTFRLPAFL+KKDY++LYDYFYSSAGS Sbjct: 208 IHTFRLPAFLVKKDYKRLYDYFYSSAGS 235 >ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum lycopersicum] gi|7677376|gb|AAF67141.1| allene oxide synthase [Solanum lycopersicum] Length = 510 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISKDEACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKDEACHNLLFATCFNSFGGMKIFFPN 326 >gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arboreum] Length = 418 Score = 72.8 bits (177), Expect = 4e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 111 VDEEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 V +EAEK+GIS++E CHN+LFATCFNTFGGMKIFFPN Sbjct: 196 VQDEAEKLGISREEVCHNLLFATCFNTFGGMKIFFPN 232 >ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|449470021|ref|XP_004152717.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449470023|ref|XP_004152718.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449496035|ref|XP_004160018.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis sativus] gi|557367638|gb|AGZ95026.1| allene oxide synthase [Cucumis sativus] Length = 532 Score = 72.0 bits (175), Expect = 7e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 126 RKTEGVDEEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + +E V EEA+++GIS++EACHN+LF TCFN+FGGMKIFFPN Sbjct: 306 KSSEAVFEEADRLGISREEACHNLLFTTCFNSFGGMKIFFPN 347 >gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] Length = 494 Score = 72.0 bits (175), Expect = 7e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GIS+DEACHN+LFATCFN+FGGMKIFFPN Sbjct: 280 EAEKLGISRDEACHNLLFATCFNSFGGMKIFFPN 313 >gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] Length = 537 Score = 72.0 bits (175), Expect = 7e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 126 RKTEGVDEEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + +E V EEA+++GIS++EACHN+LF TCFN+FGGMKIFFPN Sbjct: 305 KSSEAVFEEADRLGISREEACHNLLFTTCFNSFGGMKIFFPN 346 >ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplastic [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 293 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] Length = 507 Score = 71.6 bits (174), Expect = 9e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 EAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 EAEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 290 EAEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 323 >gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/35 (80%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAE+MG++++EACHNILFATCFNTFGG+KIFFPN Sbjct: 305 DEAERMGLTREEACHNILFATCFNTFGGLKIFFPN 339 Score = 58.5 bits (140), Expect = 8e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 106 IHTFRLPAFLIKKDYQKLYDYFYSSAGS 189 IHTFRLPAF+IKKDYQ+LYDYFYSS GS Sbjct: 275 IHTFRLPAFIIKKDYQRLYDYFYSSGGS 302 >gb|AGV22361.1| chloroplast allene oxide synthase 6 [Gossypium arboreum] Length = 523 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 111 VDEEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + +EAEK+ IS++EACHN+LFATCFN+FGGMKIFFPN Sbjct: 301 IQDEAEKLSISREEACHNLLFATCFNSFGGMKIFFPN 337 >gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] Length = 518 Score = 69.7 bits (169), Expect = 4e-10 Identities = 27/35 (77%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAE++GI++DEACHN+LFATCFN+FGGMK+FFPN Sbjct: 298 DEAERLGITRDEACHNLLFATCFNSFGGMKLFFPN 332 >ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796032|gb|ABB91777.1| allene oxide synthase [Glycine max] gi|169786998|gb|ACA79943.1| chloroplast allene oxide synthase [Glycine max] Length = 519 Score = 69.7 bits (169), Expect = 4e-10 Identities = 27/35 (77%), Positives = 35/35 (100%) Frame = -3 Query: 105 EEAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 +EAE++GI++DEACHN+LFATCFN+FGGMK+FFPN Sbjct: 299 DEAERLGITRDEACHNLLFATCFNSFGGMKLFFPN 333