BLASTX nr result
ID: Jatropha_contig00021302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021302 (569 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516605.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002516605.1| conserved hypothetical protein [Ricinus communis] gi|223544425|gb|EEF45946.1| conserved hypothetical protein [Ricinus communis] Length = 329 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = +2 Query: 65 EPAPELFWAPAPLNAKSWXXXXXXXXXXXXXXXXP---VWGSSEPQQTDDKP 211 E PE+FWAPAPLNAKSW P VWGSSEPQ +DDKP Sbjct: 55 ETEPEVFWAPAPLNAKSWADVDDEDDDDYYATTAPPQAVWGSSEPQLSDDKP 106