BLASTX nr result
ID: Jatropha_contig00021261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021261 (215 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 73 4e-11 gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 72 7e-11 gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] 72 7e-11 ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplas... 71 1e-10 gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] 71 2e-10 gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arbor... 70 3e-10 gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] 70 3e-10 ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplas... 70 4e-10 gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] 70 4e-10 gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] 70 4e-10 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 70 4e-10 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 70 4e-10 gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] 70 4e-10 emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] 70 4e-10 gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] 70 4e-10 ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|4... 69 5e-10 gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] 69 5e-10 gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus... 69 6e-10 gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] 69 8e-10 dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] 69 8e-10 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEKMGIS+DEACHN+LFATCFNTFGGMKIFFPN Sbjct: 303 AEKMGISRDEACHNLLFATCFNTFGGMKIFFPN 335 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 100 PLIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 PLIHTFRLPAFLIKKDY++LYDYF SSAGS+L+EAEK Sbjct: 269 PLIHTFRLPAFLIKKDYKRLYDYFNSSAGSLLDEAEK 305 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 72.0 bits (175), Expect = 7e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 85 AHLLGPLIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 A L P IHTFRLPAFL+KKDY++LYDYFYSSAGS+L+EAEK Sbjct: 268 AFLEEPTIHTFRLPAFLVKKDYKRLYDYFYSSAGSLLDEAEK 309 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 307 AEKMGISREEACHNILFATCFNTFGGLKIFFPN 339 >gb|AAS86334.1| allene oxide synthase [Hevea brasiliensis] Length = 457 Score = 72.0 bits (175), Expect = 7e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 85 AHLLGPLIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 A L P IHTFRLPAFL+KKDY++LYDYFYSSAGS+L+EAEK Sbjct: 201 AFLEEPTIHTFRLPAFLVKKDYKRLYDYFYSSAGSLLDEAEK 242 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEKMGIS++EACHNILFATCFNTFGG+KIFFPN Sbjct: 240 AEKMGISREEACHNILFATCFNTFGGLKIFFPN 272 >ref|XP_004251161.1| PREDICTED: allene oxide synthase, chloroplastic-like [Solanum lycopersicum] gi|7677376|gb|AAF67141.1| allene oxide synthase [Solanum lycopersicum] Length = 510 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISKDEACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKDEACHNLLFATCFNSFGGMKIFFPN 326 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 L+HTFRLP L+KKDYQ+LYD+FY+++ ++ EAEK Sbjct: 261 LLHTFRLPPILVKKDYQRLYDFFYTNSANLFIEAEK 296 >gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 100 PLIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 P IHTFRLPAF+IKKDYQ+LYDYFYSS GSVL+EAE+ Sbjct: 273 PTIHTFRLPAFIIKKDYQRLYDYFYSSGGSVLDEAER 309 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AE+MG++++EACHNILFATCFNTFGG+KIFFPN Sbjct: 307 AERMGLTREEACHNILFATCFNTFGGLKIFFPN 339 >gb|AGV22360.1| allene oxide synthase 2, partial [Gossypium arboreum] Length = 418 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 111 VDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 V + AEK+GIS++E CHN+LFATCFNTFGGMKIFFPN Sbjct: 196 VQDEAEKLGISREEVCHNLLFATCFNTFGGMKIFFPN 232 >gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] Length = 494 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GIS+DEACHN+LFATCFN+FGGMKIFFPN Sbjct: 281 AEKLGISRDEACHNLLFATCFNSFGGMKIFFPN 313 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP L+KKDYQKLYD+FY ++G +L EAEK Sbjct: 248 ILHTFRLPPGLVKKDYQKLYDFFYENSGMILNEAEK 283 >ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplastic [Solanum tuberosum] Length = 510 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ S+ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEK 296 >gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 >gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ ++ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSANLFVEAEK 296 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ S+ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEK 296 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ S+ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEK 296 >gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ ++ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSANLFVEAEK 296 >emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] Length = 509 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 294 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 326 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ S+ EAEK Sbjct: 261 ILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEK 296 >gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] Length = 507 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 99 AEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 AEK+GISK+EACHN+LFATCFN+FGGMKIFFPN Sbjct: 291 AEKLGISKEEACHNLLFATCFNSFGGMKIFFPN 323 Score = 58.5 bits (140), Expect = 8e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 ++HTFRLP FL+KKDYQ+LYD+FY+++ S+ EAEK Sbjct: 258 ILHTFRLPPFLVKKDYQRLYDFFYTNSASLFAEAEK 293 >ref|NP_001274390.1| allene oxide synthase [Cucumis sativus] gi|449470021|ref|XP_004152717.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449470023|ref|XP_004152718.1| PREDICTED: allene oxide synthase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449496035|ref|XP_004160018.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cucumis sativus] gi|557367638|gb|AGZ95026.1| allene oxide synthase [Cucumis sativus] Length = 532 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -3 Query: 126 RKTEGVDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + +E V E A+++GIS++EACHN+LF TCFN+FGGMKIFFPN Sbjct: 306 KSSEAVFEEADRLGISREEACHNLLFTTCFNSFGGMKIFFPN 347 >gb|AAM66138.1|AF081954_1 allene oxide synthase [Cucumis melo] Length = 537 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -3 Query: 126 RKTEGVDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + +E V E A+++GIS++EACHN+LF TCFN+FGGMKIFFPN Sbjct: 305 KSSEAVFEEADRLGISREEACHNLLFTTCFNSFGGMKIFFPN 346 >gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] Length = 518 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 129 SRKTEGVDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 S T +DE AE++GI++DEACHN+LFATCFN+FGGMK+FFPN Sbjct: 291 SSSTSVLDE-AERLGITRDEACHNLLFATCFNSFGGMKLFFPN 332 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 106 IHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAEK 210 I TFRLP LIKKDYQ+LYD+FYSS+ SVL+EAE+ Sbjct: 268 IRTFRLPPSLIKKDYQRLYDFFYSSSTSVLDEAER 302 >gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] Length = 376 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 129 SRKTEGVDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + TE +DE AE +G+S++EACHN+LFATCFN+FGGMKIFFPN Sbjct: 149 ANSTEILDE-AENLGLSREEACHNLLFATCFNSFGGMKIFFPN 190 Score = 55.8 bits (133), Expect = 5e-06 Identities = 22/35 (62%), Positives = 32/35 (91%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAE 207 L+HTFRLPA L+KKDYQ+LY++FY+++ +L+EAE Sbjct: 125 LLHTFRLPAALVKKDYQRLYEFFYANSTEILDEAE 159 >dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] Length = 519 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 129 SRKTEGVDEGAEKMGISKDEACHNILFATCFNTFGGMKIFFPN 1 + TE +DE AE +G+S++EACHN+LFATCFN+FGGMKIFFPN Sbjct: 292 ANSTEILDE-AENLGLSREEACHNLLFATCFNSFGGMKIFFPN 333 Score = 55.8 bits (133), Expect = 5e-06 Identities = 22/35 (62%), Positives = 32/35 (91%) Frame = +1 Query: 103 LIHTFRLPAFLIKKDYQKLYDYFYSSAGSVLEEAE 207 L+HTFRLPA L+KKDYQ+LY++FY+++ +L+EAE Sbjct: 268 LLHTFRLPAALVKKDYQRLYEFFYANSTEILDEAE 302