BLASTX nr result
ID: Jatropha_contig00021155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00021155 (284 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521293.1| nascent polypeptide associated complex alpha... 71 2e-10 gb|EEE96716.2| hypothetical protein POPTR_0012s00690g [Populus t... 69 8e-10 ref|XP_002321358.1| predicted protein [Populus trichocarpa] gi|2... 69 8e-10 gb|ABK93574.1| unknown [Populus trichocarpa] gi|550321675|gb|ERP... 69 8e-10 gb|EMJ19563.1| hypothetical protein PRUPE_ppa011150mg [Prunus pe... 61 1e-07 ref|XP_006291811.1| hypothetical protein CARUB_v10017987mg [Caps... 60 2e-07 gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis tha... 60 2e-07 ref|NP_190516.1| nascent polypeptide-associated complex subunit ... 60 2e-07 ref|XP_002875967.1| nascent polypeptide-associated complex domai... 60 2e-07 gb|EOY23718.1| Nascent polypeptide-associated complex subunit al... 60 3e-07 ref|XP_003634163.1| PREDICTED: nascent polypeptide-associated co... 60 4e-07 gb|ESQ45588.1| hypothetical protein EUTSA_v10010701mg [Eutrema s... 59 5e-07 gb|ESR54506.1| hypothetical protein CICLE_v10022215mg [Citrus cl... 58 1e-06 ref|XP_004502772.1| PREDICTED: nascent polypeptide-associated co... 57 2e-06 ref|XP_006347524.1| PREDICTED: nascent polypeptide-associated co... 57 3e-06 ref|XP_004235032.1| PREDICTED: nascent polypeptide-associated co... 57 3e-06 ref|XP_002882776.1| predicted protein [Arabidopsis lyrata subsp.... 57 3e-06 gb|AFK33649.1| unknown [Lotus japonicus] 56 4e-06 gb|AFK39074.1| unknown [Lotus japonicus] 56 5e-06 gb|ESW08420.1| hypothetical protein PHAVU_009G044200g [Phaseolus... 55 7e-06 >ref|XP_002521293.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223539478|gb|EEF41067.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 228 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 GTPGANGSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 70 GTPGANGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 110 >gb|EEE96716.2| hypothetical protein POPTR_0012s00690g [Populus trichocarpa] Length = 229 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +2 Query: 164 TPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 TPGANGSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 72 TPGANGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 111 >ref|XP_002321358.1| predicted protein [Populus trichocarpa] gi|222868354|gb|EEF05485.1| nascent polypeptide-associated complex domain-containing family protein [Populus trichocarpa] Length = 225 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +2 Query: 164 TPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 TPGANGSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 68 TPGANGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 107 >gb|ABK93574.1| unknown [Populus trichocarpa] gi|550321675|gb|ERP51878.1| hypothetical protein POPTR_0015s00570g [Populus trichocarpa] Length = 224 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +2 Query: 164 TPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 TPGANGSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 67 TPGANGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 106 >gb|EMJ19563.1| hypothetical protein PRUPE_ppa011150mg [Prunus persica] Length = 222 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G G N SSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 64 GAQGGNESSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 104 >ref|XP_006291811.1| hypothetical protein CARUB_v10017987mg [Capsella rubella] gi|482560518|gb|EOA24709.1| hypothetical protein CARUB_v10017987mg [Capsella rubella] Length = 222 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 170 GANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G +GSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 67 GVSGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 104 >gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis thaliana] gi|18377570|gb|AAL66951.1| alpha NAC-like protein [Arabidopsis thaliana] Length = 217 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 170 GANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G +GSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 62 GVSGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 99 >ref|NP_190516.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] gi|71151985|sp|Q94JX9.2|NACA2_ARATH RecName: Full=Nascent polypeptide-associated complex subunit alpha-like protein 2; Short=NAC-alpha-like protein 2; AltName: Full=Alpha-NAC-like protein 2 gi|12324452|gb|AAG52192.1|AC012329_19 putative alpha NAC; 61864-63065 [Arabidopsis thaliana] gi|6561948|emb|CAB62452.1| alpha NAC-like protein [Arabidopsis thaliana] gi|332645026|gb|AEE78547.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] Length = 217 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 170 GANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G +GSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 62 GVSGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 99 >ref|XP_002875967.1| nascent polypeptide-associated complex domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297321805|gb|EFH52226.1| nascent polypeptide-associated complex domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 217 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 170 GANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G +GSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 62 GVSGSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 99 >gb|EOY23718.1| Nascent polypeptide-associated complex subunit alpha-like protein 2 [Theobroma cacao] Length = 254 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 173 ANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 ANG SKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 100 ANGGSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 136 >ref|XP_003634163.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2-like [Vitis vinifera] gi|302143993|emb|CBI23098.3| unnamed protein product [Vitis vinifera] Length = 210 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G GAN SKQSRSEKKS KAMLKLGMKPVTGV + T RT Sbjct: 52 GAQGANEGSKQSRSEKKSRKAMLKLGMKPVTGVGRVTIKRT 92 >gb|ESQ45588.1| hypothetical protein EUTSA_v10010701mg [Eutrema salsugineum] Length = 221 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 170 GANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G +G+SKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 66 GVSGNSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 103 >gb|ESR54506.1| hypothetical protein CICLE_v10022215mg [Citrus clementina] Length = 213 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 179 GSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 GSSKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 61 GSSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 95 >ref|XP_004502772.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2-like [Cicer arietinum] Length = 220 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G G SSKQSRSEKKS KAMLKLG+KP+TGVS+ T RT Sbjct: 63 GAQGGTESSKQSRSEKKSRKAMLKLGLKPITGVSRVTIKRT 103 >ref|XP_006347524.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2-like [Solanum tuberosum] Length = 204 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 179 GSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G+SKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 53 GNSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 87 >ref|XP_004235032.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2-like [Solanum lycopersicum] Length = 204 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 179 GSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G+SKQSRSEKKS KAMLKLGMKPVTGVS+ T RT Sbjct: 53 GNSKQSRSEKKSRKAMLKLGMKPVTGVSRVTIKRT 87 >ref|XP_002882776.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328616|gb|EFH59035.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 175 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 167 PGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGT 271 P A G SKQSRSEKKS KAMLKLGMKP+TGVS+ T Sbjct: 23 PEAGGKSKQSRSEKKSRKAMLKLGMKPITGVSRVT 57 >gb|AFK33649.1| unknown [Lotus japonicus] Length = 220 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G G SKQSRSEKKS KAMLKLG+KPVTGVS+ T RT Sbjct: 61 GAQGTTEGSKQSRSEKKSRKAMLKLGLKPVTGVSRVTIKRT 101 >gb|AFK39074.1| unknown [Lotus japonicus] Length = 227 Score = 55.8 bits (133), Expect = 5e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G G + SKQSRSEKKS KAMLKLG+KPVTGVS+ T RT Sbjct: 70 GALGGSEGSKQSRSEKKSRKAMLKLGLKPVTGVSRVTIKRT 110 >gb|ESW08420.1| hypothetical protein PHAVU_009G044200g [Phaseolus vulgaris] Length = 221 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 161 GTPGANGSSKQSRSEKKSLKAMLKLGMKPVTGVSKGTSMRT 283 G G SKQSRSEKKS KAMLKLG+KPVTGVS+ T RT Sbjct: 66 GAQGGAEGSKQSRSEKKSRKAMLKLGLKPVTGVSRVTIKRT 106