BLASTX nr result
ID: Jatropha_contig00020928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020928 (229 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] 103 2e-20 ref|XP_002334856.1| predicted protein [Populus trichocarpa] 103 3e-20 ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|2... 103 3e-20 ref|XP_002327273.1| predicted protein [Populus trichocarpa] gi|1... 103 3e-20 ref|XP_002304285.1| predicted protein [Populus trichocarpa] gi|2... 103 3e-20 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform... 102 4e-20 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobr... 102 4e-20 ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like is... 102 4e-20 ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like is... 102 4e-20 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus cl... 101 9e-20 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform... 101 1e-19 ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [V... 100 2e-19 gb|ESR44737.1| hypothetical protein CICLE_v10002413mg [Citrus cl... 100 2e-19 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 100 3e-19 ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus com... 100 3e-19 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus pe... 99 4e-19 ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-like is... 98 9e-19 emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] 97 3e-18 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus... 96 5e-18 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus... 96 5e-18 >gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] Length = 204 Score = 103 bits (257), Expect = 2e-20 Identities = 51/63 (80%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >ref|XP_002334856.1| predicted protein [Populus trichocarpa] Length = 140 Score = 103 bits (256), Expect = 3e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|224137010|ref|XP_002327000.1| predicted protein [Populus trichocarpa] gi|222842976|gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa] gi|550323569|gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa] Length = 204 Score = 103 bits (256), Expect = 3e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_002327273.1| predicted protein [Populus trichocarpa] gi|118483198|gb|ABK93503.1| unknown [Populus trichocarpa] gi|550325502|gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa] gi|550342649|gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa] Length = 204 Score = 103 bits (256), Expect = 3e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_002304285.1| predicted protein [Populus trichocarpa] gi|224138624|ref|XP_002326649.1| predicted protein [Populus trichocarpa] gi|118484142|gb|ABK93954.1| unknown [Populus trichocarpa] gi|550347360|gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa] Length = 204 Score = 103 bits (256), Expect = 3e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma cacao] Length = 204 Score = 102 bits (255), Expect = 4e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao] Length = 204 Score = 102 bits (255), Expect = 4e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449488656|ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] Length = 204 Score = 102 bits (255), Expect = 4e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449458363|ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] gi|449520285|ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449520287|ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] Length = 204 Score = 102 bits (255), Expect = 4e-20 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina] Length = 273 Score = 101 bits (252), Expect = 9e-20 Identities = 49/67 (73%), Positives = 55/67 (82%) Frame = +2 Query: 29 EEQRMGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKA 208 +++ MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARRL YKA Sbjct: 66 DDRTMGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKA 124 Query: 209 KQGYVIY 229 KQGYV+Y Sbjct: 125 KQGYVVY 131 >gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma cacao] gi|508777037|gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma cacao] Length = 206 Score = 101 bits (251), Expect = 1e-19 Identities = 49/63 (77%), Positives = 53/63 (84%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 +GAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV HPTR KARRL YKAKQGY Sbjct: 3 VGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGY 61 Query: 221 VIY 229 V+Y Sbjct: 62 VVY 64 >ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [Vitis vinifera] Length = 204 Score = 100 bits (249), Expect = 2e-19 Identities = 50/63 (79%), Positives = 52/63 (82%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >gb|ESR44737.1| hypothetical protein CICLE_v10002413mg [Citrus clementina] Length = 220 Score = 100 bits (248), Expect = 2e-19 Identities = 49/63 (77%), Positives = 52/63 (82%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/63 (77%), Positives = 52/63 (82%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARR+ YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis] gi|223529794|gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/63 (77%), Positives = 52/63 (82%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARR+ YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica] Length = 204 Score = 99.4 bits (246), Expect = 4e-19 Identities = 48/63 (76%), Positives = 52/63 (82%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSE+WR++ RFLQRVRCWEYRQHPSIVRV PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSEIWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Vitis vinifera] Length = 204 Score = 98.2 bits (243), Expect = 9e-19 Identities = 49/63 (77%), Positives = 51/63 (80%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAY YVSELWR++ RFLQRVRCWEYRQHPSIVRV PTR KARRL YKAKQGY Sbjct: 1 MGAYMYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] Length = 204 Score = 96.7 bits (239), Expect = 3e-18 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQHPSIV PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 VIY Sbjct: 60 VIY 62 >gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris] Length = 204 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/63 (74%), Positives = 51/63 (80%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQ PSIVR+ PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62 >gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris] Length = 204 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/63 (74%), Positives = 51/63 (80%) Frame = +2 Query: 41 MGAYKYVSELWREEPFPCQERFLQRVRCWEYRQHPSIVRVPHPTRLRKARRLVYKAKQGY 220 MGAYKYVSELWR++ RFLQRVRCWEYRQ PSIVR+ PTR KARRL YKAKQGY Sbjct: 1 MGAYKYVSELWRKKQSDVM-RFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGY 59 Query: 221 VIY 229 V+Y Sbjct: 60 VVY 62