BLASTX nr result
ID: Jatropha_contig00020552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020552 (560 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGJ71684.1| metallothionein type2-like protein [Jatropha curcas] 74 2e-11 >gb|AGJ71684.1| metallothionein type2-like protein [Jatropha curcas] Length = 80 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 137 KMYPDMSFSEKNTAETQVLGVAPEKARCVNGSEVGVGAE 253 KMYPDMSFSEKNTAETQVLGVAPEKAR V+G EVGVGAE Sbjct: 25 KMYPDMSFSEKNTAETQVLGVAPEKARFVDGGEVGVGAE 63