BLASTX nr result
ID: Jatropha_contig00020529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020529 (599 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatul... 176 2e-57 ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncat... 177 5e-57 ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatul... 177 6e-57 gb|AGS12723.1| ribosomal protein L23 (chloroplast) [Bhesa archbo... 140 5e-40 ref|YP_001718479.1| ribosomal protein L23 [Manihot esculenta] gi... 140 5e-40 ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina... 140 6e-40 gb|AGS12730.1| ribosomal protein L23 (chloroplast) [Chrysobalanu... 140 1e-39 gb|AGS12740.1| ribosomal protein L23 (chloroplast) [Klainedoxa g... 139 1e-39 gb|AGS12721.1| ribosomal protein L23 (chloroplast) [Bergia texana] 140 2e-39 gb|AGS12746.1| ribosomal protein L23 (chloroplast) [Pera bicolor] 138 2e-39 gb|AGS12735.1| ribosomal protein L23 (chloroplast) [Erythroxylum... 138 2e-39 ref|YP_247642.1| ribosomal protein L23 [Cucumis sativus] gi|6816... 138 3e-39 gb|AEK71432.1| ribosomal protein L23 [Carica papaya] 138 3e-39 ref|YP_817525.1| ribosomal protein L23 [Coffea arabica] gi|11661... 138 3e-39 gb|AGS12744.1| ribosomal protein L23 (chloroplast) [Ochthocosmus... 137 4e-39 gb|AGS12729.1| ribosomal protein L23 (chloroplast) [Centroplacus... 137 4e-39 gb|AEK71798.1| ribosomal protein L23 [Erythrospermum phytolaccoi... 137 4e-39 gb|ADD30257.1| ribosomal protein L23 [Berberidopsis corallina] g... 137 4e-39 gb|AGS12719.1| ribosomal protein L23 (chloroplast) [Balanops vie... 140 5e-39 ref|YP_004327723.1| ribosomal protein L23 [Hevea brasiliensis] g... 140 5e-39 >ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355506963|gb|AES88105.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 176 bits (445), Expect(2) = 2e-57 Identities = 97/147 (65%), Positives = 98/147 (66%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLP GRRMRPIMGH HY+RMIIT Sbjct: 61 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPINGRRMRPIMGHRPHYKRMIIT------ 114 Query: 338 IPPLRKKRT*IKILNSMAIHLYNTSSPSTRYGAVDSLVKSNTRYNLIYGQHRCGKGRNAR 517 MAIHLY TS PSTR TR LIYGQH CGKGRNAR Sbjct: 115 ----------------MAIHLYKTSIPSTR-----------TRNRLIYGQHHCGKGRNAR 147 Query: 518 GIITARHRGRSHKRLYR*IDFRRNGKD 598 GIITA HRG HKRLYR IDFRRN KD Sbjct: 148 GIITAGHRGGGHKRLYRKIDFRRNEKD 174 Score = 73.2 bits (178), Expect(2) = 2e-57 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 46 ILIETRTHREENRFMDGIKYAVFTDKSIRLLGKNQYT 156 I IETRTHREENRFM+GIKYA+FTDKSIRLLGKNQYT Sbjct: 23 IRIETRTHREENRFMNGIKYAIFTDKSIRLLGKNQYT 59 >ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncatula] gi|355507116|gb|AES88258.1| 50S ribosomal protein L2-B [Medicago truncatula] Length = 382 Score = 177 bits (450), Expect(2) = 5e-57 Identities = 98/147 (66%), Positives = 99/147 (67%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLP KGRRMRPIMGH HY+RMIIT Sbjct: 61 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPIKGRRMRPIMGHRPHYKRMIIT------ 114 Query: 338 IPPLRKKRT*IKILNSMAIHLYNTSSPSTRYGAVDSLVKSNTRYNLIYGQHRCGKGRNAR 517 MAIHLY TS PSTR TR LIYGQH CGKGRNAR Sbjct: 115 ----------------MAIHLYKTSIPSTR-----------TRNRLIYGQHHCGKGRNAR 147 Query: 518 GIITARHRGRSHKRLYR*IDFRRNGKD 598 GIITA HRG HKRLYR IDFRRN KD Sbjct: 148 GIITAGHRGGGHKRLYRKIDFRRNEKD 174 Score = 69.7 bits (169), Expect(2) = 5e-57 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 46 ILIETRTHREENRFMDGIKYAVFTDKSIRLLGKNQYT 156 I IETRTHREENRFM+GIK A+FTDKSIRLLGKNQYT Sbjct: 23 IRIETRTHREENRFMNGIKNAIFTDKSIRLLGKNQYT 59 >ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355488630|gb|AES69833.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 177 bits (450), Expect(2) = 6e-57 Identities = 98/147 (66%), Positives = 99/147 (67%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLP KGRRMRPIMGH HY+RMIIT Sbjct: 61 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPIKGRRMRPIMGHRPHYKRMIIT------ 114 Query: 338 IPPLRKKRT*IKILNSMAIHLYNTSSPSTRYGAVDSLVKSNTRYNLIYGQHRCGKGRNAR 517 MAIHLY TS PSTR TR LIYGQH CGKGRNAR Sbjct: 115 ----------------MAIHLYKTSIPSTR-----------TRNRLIYGQHHCGKGRNAR 147 Query: 518 GIITARHRGRSHKRLYR*IDFRRNGKD 598 GIITA HRG HKRLYR IDFRRN KD Sbjct: 148 GIITAGHRGGGHKRLYRKIDFRRNEKD 174 Score = 69.7 bits (169), Expect(2) = 6e-57 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 46 ILIETRTHREENRFMDGIKYAVFTDKSIRLLGKNQYT 156 I IETRTHREENRFM+GIK A+FTDKSIRLLGKNQYT Sbjct: 23 IRIETRTHREENRFMNGIKNAIFTDKSIRLLGKNQYT 59 >gb|AGS12723.1| ribosomal protein L23 (chloroplast) [Bhesa archboldiana] gi|527354799|gb|AGS12738.1| ribosomal protein L23 (chloroplast) [Humiria balsamifera] gi|527354805|gb|AGS12742.1| ribosomal protein L23 (chloroplast) [Microdesmis puberula] Length = 93 Score = 140 bits (354), Expect(2) = 5e-40 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 5e-40 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >ref|YP_001718479.1| ribosomal protein L23 [Manihot esculenta] gi|169794134|ref|YP_001718497.1| ribosomal protein L23 [Manihot esculenta] gi|225544165|ref|YP_002720154.1| rpl23 [Jatropha curcas] gi|225544185|ref|YP_002720175.1| rpl23 [Jatropha curcas] gi|372450182|ref|YP_005090220.1| rpl23 gene product (chloroplast) [Ricinus communis] gi|372450202|ref|YP_005090240.1| rpl23 gene product (chloroplast) [Ricinus communis] gi|157695927|gb|ABV66196.1| ribosomal protein L23 [Manihot esculenta] gi|157695946|gb|ABV66215.1| ribosomal protein L23 [Manihot esculenta] gi|224979606|gb|ACN72733.1| rpl23 [Jatropha curcas] gi|224979626|gb|ACN72753.1| rpl23 [Jatropha curcas] gi|339516208|gb|AEJ82598.1| ribosomal protein L23 [Ricinus communis] gi|339516228|gb|AEJ82618.1| ribosomal protein L23 [Ricinus communis] gi|527354787|gb|AGS12731.1| ribosomal protein L23 (chloroplast) [Clusia rosea] gi|527354790|gb|AGS12733.1| ribosomal protein L23 (chloroplast) [Ctenolophon englerianus] gi|527354818|gb|AGS12750.1| ribosomal protein L23 (chloroplast) [Viola kitaibeliana] Length = 93 Score = 140 bits (354), Expect(2) = 5e-40 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 5e-40 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|377829934|ref|YP_005296161.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|340806942|gb|AEK71570.1| ribosomal protein L23 [Spiraea tomentosa] gi|371532663|gb|AEX31773.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] gi|371532682|gb|AEX31792.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] Length = 93 Score = 140 bits (353), Expect(2) = 6e-40 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES LTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRM PIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 6e-40 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12730.1| ribosomal protein L23 (chloroplast) [Chrysobalanus icaco] Length = 93 Score = 140 bits (354), Expect(2) = 1e-39 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 48.5 bits (114), Expect(2) = 1e-39 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGI+YAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIQYAVFTDKSIRLLGKNQYT 23 >gb|AGS12740.1| ribosomal protein L23 (chloroplast) [Klainedoxa gabonensis] Length = 93 Score = 139 bits (350), Expect(2) = 1e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVE FFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVEFFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 1e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12721.1| ribosomal protein L23 (chloroplast) [Bergia texana] Length = 93 Score = 140 bits (354), Expect(2) = 2e-39 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 48.1 bits (113), Expect(2) = 2e-39 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 M+GIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MNGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12746.1| ribosomal protein L23 (chloroplast) [Pera bicolor] Length = 93 Score = 138 bits (348), Expect(2) = 2e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES T TEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTSTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 2e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12735.1| ribosomal protein L23 (chloroplast) [Erythroxylum sp. CD-2013] Length = 93 Score = 138 bits (348), Expect(2) = 2e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TR EIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRPEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 2e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >ref|YP_247642.1| ribosomal protein L23 [Cucumis sativus] gi|68164866|ref|YP_247662.1| ribosomal protein L23 [Cucumis sativus] gi|91984034|ref|YP_567120.1| ribosomal protein L23 [Vitis vinifera] gi|91984057|ref|YP_567141.1| ribosomal protein L23 [Vitis vinifera] gi|283795009|ref|YP_003359400.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|283795031|ref|YP_003359422.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|330850784|ref|YP_004376462.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|330850806|ref|YP_004376484.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334700323|ref|YP_004563822.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334700345|ref|YP_004563844.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334701660|ref|YP_004564045.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334701682|ref|YP_004564067.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334701929|ref|YP_004564538.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334701951|ref|YP_004564560.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|346578234|ref|YP_004841826.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|346578257|ref|YP_004841848.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|435856416|ref|YP_007317291.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|435856437|ref|YP_007317312.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|501770897|ref|YP_007889904.1| ribosomal protein L23 [Francoa sonchifolia] gi|501770914|ref|YP_007889920.1| ribosomal protein L23 [Francoa sonchifolia] gi|511348379|ref|YP_008081308.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|511348400|ref|YP_008081329.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|542688169|ref|YP_008520182.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|542688170|ref|YP_008520205.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|545719380|ref|YP_008578582.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|545719381|ref|YP_008578601.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|545907234|ref|YP_008578665.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|545907252|ref|YP_008578684.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|552539643|ref|YP_008592800.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|552539644|ref|YP_008592823.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|552540892|ref|YP_008592910.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|552540917|ref|YP_008592886.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|552540985|ref|YP_008592976.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|552540986|ref|YP_008592999.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|552541079|ref|YP_008593154.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|552541080|ref|YP_008593177.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|552546238|ref|YP_008593065.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|552546239|ref|YP_008593088.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|75317295|sp|Q4VZK6.1|RK23_CUCSA RecName: Full=50S ribosomal protein L23, chloroplastic gi|122246605|sp|Q0ZIV5.1|RK23_VITVI RecName: Full=50S ribosomal protein L23, chloroplastic gi|67511441|emb|CAJ00801.1| ribosomal protein L23 [Cucumis sativus] gi|67511461|emb|CAJ00821.1| ribosomal protein L23 [Cucumis sativus] gi|74027142|gb|AAZ94692.1| ribosomal protein L23 [Cucumis sativus] gi|74027159|gb|AAZ94709.1| ribosomal protein L23 [Cucumis sativus] gi|91701692|gb|ABE47576.1| ribosomal protein L23 [Vitis vinifera] gi|91701715|gb|ABE47599.1| ribosomal protein L23 [Vitis vinifera] gi|115432846|gb|ABI97459.1| ribosomal protein L23 [Cucumis sativus] gi|115432863|gb|ABI97476.1| ribosomal protein L23 [Cucumis sativus] gi|115498346|gb|ABI98788.1| ribosomal protein L23 [Cucumis sativus] gi|115498366|gb|ABI98808.1| ribosomal protein L23 [Cucumis sativus] gi|146261189|gb|ABQ14814.1| ribosomal protein L23 [Cercidiphyllum japonicum] gi|146261198|gb|ABQ14822.1| ribosomal protein L23 [Daphniphyllum sp. 205-82] gi|146261207|gb|ABQ14830.1| ribosomal protein L23 [Hamamelis japonica] gi|146261247|gb|ABQ14866.1| ribosomal protein L23 [Liquidambar styraciflua] gi|146261303|gb|ABQ14916.1| ribosomal protein L23 [Rhodoleia championii] gi|281428728|gb|ADA69967.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|281428750|gb|ADA69989.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|290487728|gb|ADD30248.1| ribosomal protein L23 [Ehretia acuminata] gi|290487730|gb|ADD30249.1| ribosomal protein L23 [Ilex cornuta] gi|290487738|gb|ADD30253.1| ribosomal protein L23 [Nerium oleander] gi|290487760|gb|ADD30264.1| ribosomal protein L23 [Liquidambar styraciflua] gi|291059295|gb|ADD72131.1| ribosomal protein L23 [Olea europaea] gi|291059318|gb|ADD72154.1| ribosomal protein L23 [Olea europaea] gi|325610348|gb|ADZ36323.1| ribosomal protein L23 [Camellia obtusifolia] gi|325610362|gb|ADZ36334.1| ribosomal protein L23 [Franklinia alatamaha] gi|325610370|gb|ADZ36341.1| ribosomal protein L23 [Gordonia lasianthus] gi|325610374|gb|ADZ36344.1| ribosomal protein L23 [Stewartia crassifolia] gi|325610378|gb|ADZ36347.1| ribosomal protein L23 [Stewartia rubiginosa] gi|325610391|gb|ADZ36358.1| ribosomal protein L23 [Symplocos paniculata] gi|325610399|gb|ADZ36365.1| ribosomal protein L23 [Ternstroemia gymnanthera] gi|326200322|gb|ADZ52361.1| ribosomal protein L23 [Asclepias syriaca] gi|326200341|gb|ADZ52380.1| ribosomal protein L23 [Asclepias syriaca] gi|328795474|emb|CBR30356.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|328795496|emb|CBR30378.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084442|emb|CBR23872.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334084464|emb|CBR23894.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334084528|emb|CBR24665.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084550|emb|CBR24688.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084614|emb|CBR30449.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084636|emb|CBR30472.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084700|emb|CBS29393.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334084722|emb|CBS29416.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334084905|emb|CBS29284.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334084927|emb|CBS29313.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334084991|emb|CBJ04339.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085013|emb|CBJ04361.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085077|emb|CBR23780.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085099|emb|CBR23802.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|340806977|gb|AEK71600.1| ribosomal protein L23 [Ehretia acuminata] gi|340806993|gb|AEK71614.1| ribosomal protein L23 [Ilex cornuta] gi|340807163|gb|AEK71757.1| ribosomal protein L23 [Liquidambar styraciflua] gi|340807171|gb|AEK71764.1| ribosomal protein L23 [Nerium oleander] gi|344030534|gb|AEM76935.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|344030557|gb|AEM76958.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|355331766|gb|AER52455.1| ribosomal protein L23 [Asclepias albicans] gi|355331784|gb|AER52473.1| ribosomal protein L23 [Asclepias albicans] gi|355331849|gb|AER52537.1| ribosomal protein L23 [Asclepias albicans] gi|355331867|gb|AER52555.1| ribosomal protein L23 [Asclepias albicans] gi|355331932|gb|AER52619.1| ribosomal protein L23 [Asclepias coulteri] gi|355331950|gb|AER52637.1| ribosomal protein L23 [Asclepias coulteri] gi|355332015|gb|AER52701.1| ribosomal protein L23 [Asclepias cutleri] gi|355332033|gb|AER52719.1| ribosomal protein L23 [Asclepias cutleri] gi|355332098|gb|AER52783.1| ribosomal protein L23 [Asclepias cutleri] gi|355332116|gb|AER52801.1| ribosomal protein L23 [Asclepias cutleri] gi|355332180|gb|AER52864.1| ribosomal protein L23 [Asclepias leptopus] gi|355332198|gb|AER52882.1| ribosomal protein L23 [Asclepias leptopus] gi|355332263|gb|AER52946.1| ribosomal protein L23 [Asclepias macrotis] gi|355332279|gb|AER52962.1| ribosomal protein L23 [Asclepias macrotis] gi|355332342|gb|AER53024.1| ribosomal protein L23 [Asclepias macrotis] gi|355332358|gb|AER53040.1| ribosomal protein L23 [Asclepias macrotis] gi|355332423|gb|AER53104.1| ribosomal protein L23 [Asclepias masonii] gi|355332441|gb|AER53122.1| ribosomal protein L23 [Asclepias masonii] gi|355332506|gb|AER53186.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332524|gb|AER53204.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332585|gb|AER53264.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332603|gb|AER53282.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332668|gb|AER53346.1| ribosomal protein L23 [Asclepias subulata] gi|355332686|gb|AER53364.1| ribosomal protein L23 [Asclepias subulata] gi|355332751|gb|AER53428.1| ribosomal protein L23 [Asclepias subulata] gi|355332769|gb|AER53446.1| ribosomal protein L23 [Asclepias subulata] gi|355332832|gb|AER53508.1| ribosomal protein L23 [Asclepias albicans x Asclepias subulata] gi|355332850|gb|AER53526.1| ribosomal protein L23 [Asclepias albicans x Asclepias subulata] gi|386268408|gb|AFJ00514.1| ribosomal protein L23 [Francoa sonchifolia] gi|386268425|gb|AFJ00531.1| ribosomal protein L23 [Francoa sonchifolia] gi|388893249|gb|AFK81341.1| ribosomal protein L23 [Camellia sinensis var. assamica] gi|388893272|gb|AFK81364.1| ribosomal protein L23 [Camellia sinensis var. assamica] gi|388893337|gb|AFK81428.1| ribosomal protein L23 [Camellia oleifera] gi|388893360|gb|AFK81451.1| ribosomal protein L23 [Camellia oleifera] gi|388893425|gb|AFK81515.1| ribosomal protein L23 [Camellia taliensis] gi|388893448|gb|AFK81538.1| ribosomal protein L23 [Camellia taliensis] gi|430728315|gb|AGA55639.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|430728336|gb|AGA55660.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|474452119|gb|AGI51187.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|474452140|gb|AGI51208.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|491650413|gb|AGL13473.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|491650434|gb|AGL13494.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|510934445|emb|CCQ09143.1| ribosomal protein L23 (chloroplast) [Olea europaea subsp. europaea] gi|510934467|emb|CCQ09165.1| ribosomal protein L23 (chloroplast) [Olea europaea subsp. europaea] gi|537362461|gb|AGU44269.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|537362462|gb|AGU44270.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|537362551|gb|AGU44358.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|537362576|gb|AGU44383.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|537362639|gb|AGU44445.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|537362640|gb|AGU44446.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|537362729|gb|AGU44534.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537362730|gb|AGU44535.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537362819|gb|AGU44623.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|537362820|gb|AGU44624.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|537362909|gb|AGU44712.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|537362910|gb|AGU44713.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|537362999|gb|AGU44801.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537363000|gb|AGU44802.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|544186380|gb|AGW04328.1| ribosomal protein L23 [Secamone afzelii] gi|544186458|gb|AGW04405.1| ribosomal protein L23 [Araujia sericifera] gi|544186536|gb|AGW04482.1| ribosomal protein L23 [Astephanus triflorus] gi|544186613|gb|AGW04558.1| ribosomal protein L23 [Eustegia minuta] gi|544186687|gb|AGW04631.1| ribosomal protein L23 [Marsdenia astephanoides] gi|544186765|gb|AGW04708.1| ribosomal protein L23 [Matelea biflora] gi|544186843|gb|AGW04785.1| ribosomal protein L23 [Orthosia scoparia] gi|544186921|gb|AGW04862.1| ribosomal protein L23 [Sisyranthus trichostomus] gi|544186999|gb|AGW04939.1| ribosomal protein L23 [Telosma cordata] gi|544187077|gb|AGW05016.1| ribosomal protein L23 [Vincetoxicum rossicum] gi|544187153|gb|AGW05091.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|544187154|gb|AGW05092.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|544187251|gb|AGW05179.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|544187269|gb|AGW05197.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|550533692|dbj|BAO01536.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533711|dbj|BAO01555.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533778|dbj|BAO01620.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533797|dbj|BAO01639.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533863|dbj|BAO01704.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533882|dbj|BAO01723.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|555945958|gb|AGZ19185.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] Length = 93 Score = 138 bits (347), Expect(2) = 3e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRM PIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 3e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AEK71432.1| ribosomal protein L23 [Carica papaya] Length = 93 Score = 138 bits (347), Expect(2) = 3e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES LTRTEIKHWVELFFGVKVIAMNSHRLPGK RRM PIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGLTRTEIKHWVELFFGVKVIAMNSHRLPGKSRRMGPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 3e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >ref|YP_817525.1| ribosomal protein L23 [Coffea arabica] gi|116617171|ref|YP_817544.1| ribosomal protein L23 [Coffea arabica] gi|122153662|sp|A0A378.1|RK23_COFAR RecName: Full=50S ribosomal protein L23, chloroplastic gi|116242206|gb|ABJ89721.1| ribosomal protein L23 [Coffea arabica] gi|116242227|gb|ABJ89742.1| ribosomal protein L23 [Coffea arabica] gi|340806845|gb|AEK71486.1| ribosomal protein L23 [Ixerba brexioides] gi|340806881|gb|AEK71517.1| ribosomal protein L23 [Melianthus comosus] Length = 93 Score = 138 bits (347), Expect(2) = 3e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRM PIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 3e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12744.1| ribosomal protein L23 (chloroplast) [Ochthocosmus sp. CD-2013] Length = 93 Score = 137 bits (346), Expect(2) = 4e-39 Identities = 66/70 (94%), Positives = 67/70 (95%) Frame = +2 Query: 155 LNVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGY 334 LNVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMR I+GHTMHYRRMIITLQPGY Sbjct: 24 LNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRAIVGHTMHYRRMIITLQPGY 83 Query: 335 SIPPLRKKRT 364 SIPPLRKKRT Sbjct: 84 SIPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 4e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12729.1| ribosomal protein L23 (chloroplast) [Centroplacus glaucinus] Length = 93 Score = 137 bits (346), Expect(2) = 4e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMR IMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRTIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 4e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AEK71798.1| ribosomal protein L23 [Erythrospermum phytolaccoides] Length = 93 Score = 137 bits (346), Expect(2) = 4e-39 Identities = 66/69 (95%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQ GYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQSGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 4e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|ADD30257.1| ribosomal protein L23 [Berberidopsis corallina] gi|340807099|gb|AEK71701.1| ribosomal protein L23 [Berberidopsis corallina] Length = 93 Score = 137 bits (346), Expect(2) = 4e-39 Identities = 65/69 (94%), Positives = 66/69 (95%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHW+ELFFGVKVIAMNSHRLPGKGRRM PIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWIELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 50.1 bits (118), Expect(2) = 4e-39 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLLGKNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYT 23 >gb|AGS12719.1| ribosomal protein L23 (chloroplast) [Balanops vieillardii] Length = 93 Score = 140 bits (354), Expect(2) = 5e-39 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 46.6 bits (109), Expect(2) = 5e-39 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLL KNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLVKNQYT 23 >ref|YP_004327723.1| ribosomal protein L23 [Hevea brasiliensis] gi|326909452|ref|YP_004327704.1| ribosomal protein L23 [Hevea brasiliensis] gi|308523547|gb|ADO33597.1| ribosomal protein L23 [Hevea brasiliensis] gi|308523566|gb|ADO33616.1| ribosomal protein L23 [Hevea brasiliensis] gi|340807203|gb|AEK71792.1| ribosomal protein L23 [Malesherbia linearifolia] Length = 93 Score = 140 bits (354), Expect(2) = 5e-39 Identities = 67/69 (97%), Positives = 67/69 (97%) Frame = +2 Query: 158 NVESRLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 337 NVES TRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS Sbjct: 25 NVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYS 84 Query: 338 IPPLRKKRT 364 IPPLRKKRT Sbjct: 85 IPPLRKKRT 93 Score = 46.6 bits (109), Expect(2) = 5e-39 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 88 MDGIKYAVFTDKSIRLLGKNQYT 156 MDGIKYAVFTDKSIRLL KNQYT Sbjct: 1 MDGIKYAVFTDKSIRLLVKNQYT 23