BLASTX nr result
ID: Jatropha_contig00020499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020499 (291 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297976.1| inner membrane protein [Populus trichocarpa]... 65 7e-09 ref|XP_002304556.1| inner membrane protein [Populus trichocarpa]... 58 1e-06 >ref|XP_002297976.1| inner membrane protein [Populus trichocarpa] gi|222845234|gb|EEE82781.1| Inner membrane protein OXA1 [Populus trichocarpa] Length = 459 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = +3 Query: 123 AYIRSLSTRANLVRRQCQFSFSYILHHDDDRKRNSIDEGPLPLRGMNSSSLQQKGF 290 AY+RSLSTRAN+VRR+ SFSYIL HDDDRK NSI+EGP +GM S+ QQ+ F Sbjct: 2 AYVRSLSTRANIVRRRYNASFSYIL-HDDDRKHNSIEEGP-SSKGM-SNLFQQRSF 54 >ref|XP_002304556.1| inner membrane protein [Populus trichocarpa] gi|222841988|gb|EEE79535.1| Inner membrane protein OXA1 [Populus trichocarpa] Length = 167 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +3 Query: 123 AYIRSLSTRANLVRRQCQFSFSYILHHDDDRKRNSIDEGPLPLRGMNSSSLQQKGF 290 A + SLSTRAN+VRR+ SFSY+L +DDRK NSIDEGP PL GM + QQK F Sbjct: 2 ACLFSLSTRANIVRRRYNASFSYVL--NDDRKHNSIDEGP-PLEGM-GNLFQQKPF 53