BLASTX nr result
ID: Jatropha_contig00020447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020447 (661 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318100.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 ref|XP_002511272.1| conserved hypothetical protein [Ricinus comm... 63 8e-08 emb|CAN76898.1| hypothetical protein VITISV_010607 [Vitis vinifera] 61 2e-07 emb|CBI14893.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002277813.1| PREDICTED: programmed cell death protein 4 [... 60 4e-07 gb|ESR53237.1| hypothetical protein CICLE_v10019069mg [Citrus cl... 60 5e-07 gb|EOY22346.1| MA3 domain-containing protein isoform 1 [Theobrom... 59 2e-06 gb|EMJ12086.1| hypothetical protein PRUPE_ppa002179mg [Prunus pe... 59 2e-06 ref|XP_002321660.1| predicted protein [Populus trichocarpa] gi|2... 59 2e-06 >ref|XP_002318100.1| predicted protein [Populus trichocarpa] gi|222858773|gb|EEE96320.1| MA3 domain-containing family protein [Populus trichocarpa] Length = 717 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH LKVPA+G+ATNAGIAVRHVRRSHSGK VRVKK Sbjct: 46 EHHLKVPAAGKATNAGIAVRHVRRSHSGKLVRVKK 80 >ref|XP_002511272.1| conserved hypothetical protein [Ricinus communis] gi|223550387|gb|EEF51874.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH L+VPA+G+A NAGIAVRHVRRSHSGK++RVKK Sbjct: 46 EHQLRVPAAGKAPNAGIAVRHVRRSHSGKFIRVKK 80 >emb|CAN76898.1| hypothetical protein VITISV_010607 [Vitis vinifera] Length = 755 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKKGE 506 EH +KVP SG+A AGIAVRHVRRSHSGK+VRVKK + Sbjct: 39 EHHIKVPVSGKAPTAGIAVRHVRRSHSGKFVRVKKAQ 75 >emb|CBI14893.3| unnamed protein product [Vitis vinifera] Length = 789 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH +KVP SG+A AGIAVRHVRRSHSGK+VRVKK Sbjct: 39 EHHIKVPVSGKAPTAGIAVRHVRRSHSGKFVRVKK 73 >ref|XP_002277813.1| PREDICTED: programmed cell death protein 4 [Vitis vinifera] Length = 704 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH +KVP SG+A AGIAVRHVRRSHSGK+VRVKK Sbjct: 39 EHHIKVPVSGKAPTAGIAVRHVRRSHSGKFVRVKK 73 >gb|ESR53237.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] gi|557542260|gb|ESR53238.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] Length = 710 Score = 60.1 bits (144), Expect = 5e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH LKVPA G+A N GIAVRHVRRSHSGK VRVKK Sbjct: 39 EHYLKVPAGGKAPNVGIAVRHVRRSHSGKLVRVKK 73 >gb|EOY22346.1| MA3 domain-containing protein isoform 1 [Theobroma cacao] gi|508775091|gb|EOY22347.1| MA3 domain-containing protein isoform 1 [Theobroma cacao] Length = 715 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 +H LKVPA G+A GIAVRHVRRSHSGK+VRVKK Sbjct: 45 DHQLKVPACGKAPTGGIAVRHVRRSHSGKFVRVKK 79 >gb|EMJ12086.1| hypothetical protein PRUPE_ppa002179mg [Prunus persica] Length = 704 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 EH +K PA G+A AGIAVRHVRRSHSGK+VRVKK Sbjct: 39 EHHVKAPAGGKAPTAGIAVRHVRRSHSGKFVRVKK 73 >ref|XP_002321660.1| predicted protein [Populus trichocarpa] gi|222868656|gb|EEF05787.1| MA3 domain-containing family protein [Populus trichocarpa] Length = 713 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 616 EHPLKVPASGEATNAGIAVRHVRRSHSGKYVRVKK 512 +H LKVPA+G++ AGIAVRHVRRSHSGK+VRVKK Sbjct: 42 DHHLKVPAAGKSGTAGIAVRHVRRSHSGKHVRVKK 76