BLASTX nr result
ID: Jatropha_contig00020394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020394 (253 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535496.1| conserved hypothetical protein [Ricinus comm... 96 5e-18 >ref|XP_002535496.1| conserved hypothetical protein [Ricinus communis] gi|255596832|ref|XP_002536626.1| conserved hypothetical protein [Ricinus communis] gi|223519048|gb|EEF25756.1| conserved hypothetical protein [Ricinus communis] gi|223522900|gb|EEF26887.1| conserved hypothetical protein [Ricinus communis] Length = 59 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +1 Query: 91 HAWSLSEIRKSMKRHLRLRKNSRKSITERSGDLVLLAGREEASGTPFSAR 240 HAWSLSE++KSMKRHLRLRKNSRKSITERSGDLVLLAGREEASG PFSAR Sbjct: 10 HAWSLSEMKKSMKRHLRLRKNSRKSITERSGDLVLLAGREEASGPPFSAR 59