BLASTX nr result
ID: Jatropha_contig00020303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020303 (150 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE83613.2| hypothetical protein POPTR_0001s29240g [Populus t... 64 3e-08 gb|ERP56933.1| hypothetical protein POPTR_0009s08350g [Populus t... 64 3e-08 gb|EEE87167.2| hypothetical protein POPTR_0009s08350g [Populus t... 64 3e-08 gb|ERP56932.1| hypothetical protein POPTR_0009s08350g [Populus t... 64 3e-08 ref|XP_002518322.1| bromodomain-containing protein, putative [Ri... 64 3e-08 ref|XP_002313212.1| global transcription factor group [Populus t... 64 3e-08 ref|XP_002298808.1| global transcription factor group [Populus t... 64 3e-08 gb|ESQ31292.1| hypothetical protein EUTSA_v10003870mg [Eutrema s... 63 3e-08 gb|ESQ31291.1| hypothetical protein EUTSA_v10003870mg [Eutrema s... 63 3e-08 ref|XP_006281511.1| hypothetical protein CARUB_v10027609mg [Caps... 63 3e-08 ref|XP_002866683.1| hypothetical protein ARALYDRAFT_919899 [Arab... 63 3e-08 ref|NP_201366.3| global transcription factor group E7 [Arabidops... 63 3e-08 dbj|BAA98182.1| unnamed protein product [Arabidopsis thaliana] 63 3e-08 gb|EOX98605.1| Global transcription factor group E2, putative is... 62 6e-08 gb|EOX98604.1| Global transcription factor group, putative isofo... 62 6e-08 gb|EOX98601.1| Global transcription factor group E2, putative is... 62 6e-08 gb|ESW20322.1| hypothetical protein PHAVU_006G199500g [Phaseolus... 61 1e-07 gb|ESW20321.1| hypothetical protein PHAVU_006G199400g [Phaseolus... 61 1e-07 ref|XP_004289817.1| PREDICTED: transcription factor GTE7-like is... 61 1e-07 ref|XP_003545749.1| PREDICTED: transcription factor GTE11-like [... 61 1e-07 >gb|EEE83613.2| hypothetical protein POPTR_0001s29240g [Populus trichocarpa] Length = 474 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 414 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 444 >gb|ERP56933.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa] gi|550331303|gb|ERP56934.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa] Length = 547 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 407 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 437 >gb|EEE87167.2| hypothetical protein POPTR_0009s08350g [Populus trichocarpa] Length = 546 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 407 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 437 >gb|ERP56932.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa] Length = 541 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 407 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 437 >ref|XP_002518322.1| bromodomain-containing protein, putative [Ricinus communis] gi|223542542|gb|EEF44082.1| bromodomain-containing protein, putative [Ricinus communis] Length = 634 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 498 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 528 >ref|XP_002313212.1| global transcription factor group [Populus trichocarpa] Length = 224 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 186 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 216 >ref|XP_002298808.1| global transcription factor group [Populus trichocarpa] Length = 474 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDRFVTNYKKM S Sbjct: 414 GDEIELDIEAVDTETLWELDRFVTNYKKMVS 444 >gb|ESQ31292.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum] Length = 597 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 450 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 480 >gb|ESQ31291.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum] Length = 568 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 421 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 451 >ref|XP_006281511.1| hypothetical protein CARUB_v10027609mg [Capsella rubella] gi|482550215|gb|EOA14409.1| hypothetical protein CARUB_v10027609mg [Capsella rubella] Length = 587 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 441 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 471 >ref|XP_002866683.1| hypothetical protein ARALYDRAFT_919899 [Arabidopsis lyrata subsp. lyrata] gi|297312518|gb|EFH42942.1| hypothetical protein ARALYDRAFT_919899 [Arabidopsis lyrata subsp. lyrata] Length = 577 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 433 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 463 >ref|NP_201366.3| global transcription factor group E7 [Arabidopsis thaliana] gi|75146221|sp|Q7Y214.1|GTE7_ARATH RecName: Full=Transcription factor GTE7; AltName: Full=Bromodomain-containing protein GTE7; AltName: Full=Protein GLOBAL TRANSCRIPTION FACTOR GROUP E7 gi|30793995|gb|AAP40447.1| unknown protein [Arabidopsis thaliana] gi|110742049|dbj|BAE98957.1| hypothetical protein [Arabidopsis thaliana] gi|133778882|gb|ABO38781.1| At5g65630 [Arabidopsis thaliana] gi|332010696|gb|AED98079.1| global transcription factor group E7 [Arabidopsis thaliana] Length = 590 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 442 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 472 >dbj|BAA98182.1| unnamed protein product [Arabidopsis thaliana] Length = 643 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVD ET+WELDRFVTNYKKMAS Sbjct: 497 GDEIELDIEAVDNETLWELDRFVTNYKKMAS 527 >gb|EOX98605.1| Global transcription factor group E2, putative isoform 5, partial [Theobroma cacao] Length = 547 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEA+DTET+WELDRFVTNYKKM S Sbjct: 430 GDEIELDIEAMDTETLWELDRFVTNYKKMVS 460 >gb|EOX98604.1| Global transcription factor group, putative isoform 4 [Theobroma cacao] Length = 483 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEA+DTET+WELDRFVTNYKKM S Sbjct: 430 GDEIELDIEAMDTETLWELDRFVTNYKKMVS 460 >gb|EOX98601.1| Global transcription factor group E2, putative isoform 1 [Theobroma cacao] gi|508706706|gb|EOX98602.1| Global transcription factor group E2, putative isoform 1 [Theobroma cacao] gi|508706707|gb|EOX98603.1| Global transcription factor group E2, putative isoform 1 [Theobroma cacao] Length = 566 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEA+DTET+WELDRFVTNYKKM S Sbjct: 430 GDEIELDIEAMDTETLWELDRFVTNYKKMVS 460 >gb|ESW20322.1| hypothetical protein PHAVU_006G199500g [Phaseolus vulgaris] Length = 531 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDR VTNYKKM S Sbjct: 386 GDEIELDIEAVDTETLWELDRLVTNYKKMVS 416 >gb|ESW20321.1| hypothetical protein PHAVU_006G199400g [Phaseolus vulgaris] Length = 527 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDR VTNYKKM S Sbjct: 385 GDEIELDIEAVDTETLWELDRLVTNYKKMVS 415 >ref|XP_004289817.1| PREDICTED: transcription factor GTE7-like isoform 1 [Fragaria vesca subsp. vesca] gi|470106953|ref|XP_004289818.1| PREDICTED: transcription factor GTE7-like isoform 2 [Fragaria vesca subsp. vesca] Length = 579 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDR VTNYKKM S Sbjct: 433 GDEIELDIEAVDTETLWELDRLVTNYKKMVS 463 >ref|XP_003545749.1| PREDICTED: transcription factor GTE11-like [Glycine max] Length = 536 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 GDEIELDIEAVDTETVWELDRFVTNYKKMAS 1 GDEIELDIEAVDTET+WELDR VTNYKKM S Sbjct: 391 GDEIELDIEAVDTETLWELDRLVTNYKKMVS 421