BLASTX nr result
ID: Jatropha_contig00020219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020219 (726 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511846.1| conserved hypothetical protein [Ricinus comm... 64 5e-08 gb|ERP53132.1| hypothetical protein POPTR_0014s07830g [Populus t... 57 6e-06 ref|XP_002320787.1| predicted protein [Populus trichocarpa] 57 6e-06 >ref|XP_002511846.1| conserved hypothetical protein [Ricinus communis] gi|223549026|gb|EEF50515.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 63.9 bits (154), Expect = 5e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 108 KTKKRPLESYVQIQECSYFKMRAVLKDIRPHLLEVHFRIHFQ 233 K+KKRPL+S VQ+Q+C+YFK+RAVLKDIRPHLLEV + F+ Sbjct: 83 KSKKRPLDSNVQLQDCTYFKIRAVLKDIRPHLLEVLRTVDFR 124 >gb|ERP53132.1| hypothetical protein POPTR_0014s07830g [Populus trichocarpa] Length = 335 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 108 KTKKRPLESYVQIQECSYFKMRAVLKDIRPHLLEVHFRIHFQ 233 ++KKRPL++ +QECSYFKMRAV+KDIRPH+LE+ + F+ Sbjct: 176 ESKKRPLDNCGPVQECSYFKMRAVVKDIRPHVLEMLGTVDFR 217 >ref|XP_002320787.1| predicted protein [Populus trichocarpa] Length = 274 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 108 KTKKRPLESYVQIQECSYFKMRAVLKDIRPHLLEVHFRIHFQ 233 ++KKRPL++ +QECSYFKMRAV+KDIRPH+LE+ + F+ Sbjct: 94 ESKKRPLDNCGPVQECSYFKMRAVVKDIRPHVLEMLGTVDFR 135