BLASTX nr result
ID: Jatropha_contig00020154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020154 (595 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525136.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 >ref|XP_002525136.1| conserved hypothetical protein [Ricinus communis] gi|223535595|gb|EEF37263.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 77.4 bits (189), Expect = 2e-12 Identities = 51/95 (53%), Positives = 62/95 (65%), Gaps = 8/95 (8%) Frame = -1 Query: 262 EATTINLYDQSN-KENIPPFSAKQENPVLAXXXXXXXXXXXXR----PLEDITYFYQSYI 98 EAT NL +N KEN+PPFS+KQ NP++ R PLEDITYFY S I Sbjct: 2 EAT--NLCKHTNHKENVPPFSSKQANPIIENVPFSSSKKGFRRRVRRPLEDITYFYGSCI 59 Query: 97 QLALAQDSDSF---LSVSVPSCASNSKKRKASEED 2 QLALA++S+S SV+V S ASNSKKRKAS+E+ Sbjct: 60 QLALAEESESVSASFSVTVSSYASNSKKRKASDEE 94