BLASTX nr result
ID: Jatropha_contig00020141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00020141 (317 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529465.1| hypothetical protein RCOM_0753050 [Ricinus c... 142 4e-32 gb|ESR65680.1| hypothetical protein CICLE_v10010548mg [Citrus cl... 134 9e-30 gb|EMJ13643.1| hypothetical protein PRUPE_ppa017208mg, partial [... 129 3e-28 gb|EOY12243.1| Stigma-specific Stig1 family protein, putative [T... 127 1e-27 gb|ERN19733.1| hypothetical protein AMTR_s00062p00210870 [Ambore... 126 3e-27 gb|EEE85131.2| hypothetical protein POPTR_0001s36570g [Populus t... 122 6e-26 ref|XP_002300326.1| predicted protein [Populus trichocarpa] 122 6e-26 ref|XP_004170565.1| PREDICTED: uncharacterized protein LOC101232... 116 2e-24 ref|XP_004514560.1| PREDICTED: uncharacterized protein LOC101498... 110 2e-22 ref|XP_003553061.1| PREDICTED: uncharacterized protein LOC100781... 108 9e-22 ref|XP_006364233.1| PREDICTED: uncharacterized protein LOC102606... 106 3e-21 gb|ESW18501.1| hypothetical protein PHAVU_006G046600g [Phaseolus... 105 6e-21 ref|XP_004236464.1| PREDICTED: uncharacterized protein LOC101256... 104 1e-20 ref|XP_004491465.1| PREDICTED: uncharacterized protein LOC101498... 100 2e-19 gb|ESQ30412.1| hypothetical protein EUTSA_v10012178mg [Eutrema s... 99 7e-19 gb|AAF87870.1|AC012561_3 Hypothetical protein [Arabidopsis thali... 96 3e-18 ref|NP_175480.1| stigma-specific stig1-like protein [Arabidopsis... 96 3e-18 ref|XP_003621922.1| hypothetical protein MTR_7g025060 [Medicago ... 96 3e-18 ref|XP_006304246.1| hypothetical protein CARUB_v10010456mg [Caps... 96 6e-18 ref|XP_004516940.1| PREDICTED: uncharacterized protein LOC101514... 95 8e-18 >ref|XP_002529465.1| hypothetical protein RCOM_0753050 [Ricinus communis] gi|223531081|gb|EEF32931.1| hypothetical protein RCOM_0753050 [Ricinus communis] Length = 229 Score = 142 bits (358), Expect = 4e-32 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARM C +N+CVDVSSDINNCG+CGIRCPFTW CC GFC++T ++PFNCG CGNKCPWGV Sbjct: 81 ARMHCCRNKCVDVSSDINNCGVCGIRCPFTWQCCHGFCINTNVSPFNCGSCGNKCPWGVL 140 Query: 136 CIYGMCGY 113 C+YGMCGY Sbjct: 141 CVYGMCGY 148 >gb|ESR65680.1| hypothetical protein CICLE_v10010548mg [Citrus clementina] Length = 196 Score = 134 bits (338), Expect = 9e-30 Identities = 50/67 (74%), Positives = 58/67 (86%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 RMRC +N+CVDV SD+NNCGLCGIRC F+W CC+GFC +T PFNCG+CGN+CPWGV C Sbjct: 78 RMRCCRNRCVDVFSDVNNCGLCGIRCRFSWQCCRGFCTNTNRGPFNCGRCGNRCPWGVRC 137 Query: 133 IYGMCGY 113 IYGMCGY Sbjct: 138 IYGMCGY 144 >gb|EMJ13643.1| hypothetical protein PRUPE_ppa017208mg, partial [Prunus persica] Length = 148 Score = 129 bits (325), Expect = 3e-28 Identities = 47/67 (70%), Positives = 61/67 (91%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 R RC K++CV++SSD+NNCGLC IRCPF+W CC+GFCV+T I+PFNCG+CGN+CP+GV C Sbjct: 45 RWRCCKDRCVNISSDVNNCGLCRIRCPFSWQCCRGFCVNTNISPFNCGRCGNRCPFGVLC 104 Query: 133 IYGMCGY 113 +YG+CGY Sbjct: 105 LYGLCGY 111 >gb|EOY12243.1| Stigma-specific Stig1 family protein, putative [Theobroma cacao] Length = 178 Score = 127 bits (320), Expect = 1e-27 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC ++QCVDV+SD+ +CGLCGIRCPFT CC+G C +T ++PFNCG+CGN+CPW V Sbjct: 71 ARMRCCRDQCVDVASDVAHCGLCGIRCPFTRQCCRGICTNTNLSPFNCGRCGNRCPWRVR 130 Query: 136 CIYGMCGY 113 C+YGMCGY Sbjct: 131 CLYGMCGY 138 >gb|ERN19733.1| hypothetical protein AMTR_s00062p00210870 [Amborella trichopoda] Length = 139 Score = 126 bits (316), Expect = 3e-27 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 +MRC KN+CVDVSSD+ NCGLCG+RCPF+W CCKG C+DT +NPF+CGKC ++CP G C Sbjct: 41 KMRCCKNRCVDVSSDMTNCGLCGVRCPFSWHCCKGICIDTNVNPFHCGKCSHRCPIGALC 100 Query: 133 IYGMCGY 113 YGMC Y Sbjct: 101 FYGMCAY 107 >gb|EEE85131.2| hypothetical protein POPTR_0001s36570g [Populus trichocarpa] Length = 150 Score = 122 bits (305), Expect = 6e-26 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDVSSD++NCG CGIRC F CC GFCVDT N F+CG+CGN+CP V Sbjct: 73 ARMRCCRNQCVDVSSDVSNCGFCGIRCRFARQCCHGFCVDTNCNRFHCGRCGNRCPRKVR 132 Query: 136 CIYGMCGY 113 C+YGMCGY Sbjct: 133 CVYGMCGY 140 >ref|XP_002300326.1| predicted protein [Populus trichocarpa] Length = 108 Score = 122 bits (305), Expect = 6e-26 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDVSSD++NCG CGIRC F CC GFCVDT N F+CG+CGN+CP V Sbjct: 38 ARMRCCRNQCVDVSSDVSNCGFCGIRCRFARQCCHGFCVDTNCNRFHCGRCGNRCPRKVR 97 Query: 136 CIYGMCGY 113 C+YGMCGY Sbjct: 98 CVYGMCGY 105 >ref|XP_004170565.1| PREDICTED: uncharacterized protein LOC101232665 [Cucumis sativus] Length = 176 Score = 116 bits (291), Expect = 2e-24 Identities = 46/66 (69%), Positives = 51/66 (77%) Frame = -2 Query: 310 MRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHCI 131 M+C K++CVD SDI NCG CG CPF CCKGFCVDT N FNCGKCGNKCP+ V C+ Sbjct: 75 MKCCKHRCVDTDSDIKNCGYCGKICPFPQQCCKGFCVDTNNNRFNCGKCGNKCPFRVRCV 134 Query: 130 YGMCGY 113 YGMCGY Sbjct: 135 YGMCGY 140 >ref|XP_004514560.1| PREDICTED: uncharacterized protein LOC101498480 [Cicer arietinum] Length = 154 Score = 110 bits (275), Expect = 2e-22 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 R C KN+CV+V+SD NNCG C IRCPF W CC+G C DT + FNCG+CG++CP+G C Sbjct: 48 RSMCCKNRCVNVTSDRNNCGWCHIRCPFNWKCCRGLCRDTNFSIFNCGRCGHRCPFGEFC 107 Query: 133 IYGMCGY 113 +GMCGY Sbjct: 108 FFGMCGY 114 >ref|XP_003553061.1| PREDICTED: uncharacterized protein LOC100781140 [Glycine max] Length = 142 Score = 108 bits (269), Expect = 9e-22 Identities = 40/67 (59%), Positives = 51/67 (76%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 R C +N+CV+V+SD NNCGLCGIRCPF W CC G C + ++ FNCGKCG++CP+G C Sbjct: 75 RSLCCRNRCVNVTSDRNNCGLCGIRCPFNWKCCGGLCRNINLSIFNCGKCGHRCPFGTLC 134 Query: 133 IYGMCGY 113 +G CGY Sbjct: 135 FFGTCGY 141 >ref|XP_006364233.1| PREDICTED: uncharacterized protein LOC102606173 [Solanum tuberosum] Length = 189 Score = 106 bits (265), Expect = 3e-21 Identities = 37/67 (55%), Positives = 52/67 (77%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 + RC +N+C+DV+SD+NNCG CGI+CPFTW CC+G C++T ++PF+CG C ++C C Sbjct: 67 KKRCCRNRCIDVTSDVNNCGFCGIKCPFTWQCCRGICINTNMSPFHCGSCVHRCQPPSLC 126 Query: 133 IYGMCGY 113 GMCGY Sbjct: 127 FNGMCGY 133 >gb|ESW18501.1| hypothetical protein PHAVU_006G046600g [Phaseolus vulgaris] Length = 138 Score = 105 bits (262), Expect = 6e-21 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 R C N+CV+VSSD NNCGLCGIRCPF W CC+G C + + NCGKCG +CP+ V C Sbjct: 71 RSLCCWNRCVNVSSDKNNCGLCGIRCPFNWQCCRGLCRNINFSSSNCGKCGQRCPYRVRC 130 Query: 133 IYGMCGY 113 +G+CGY Sbjct: 131 SFGVCGY 137 >ref|XP_004236464.1| PREDICTED: uncharacterized protein LOC101256963 [Solanum lycopersicum] Length = 190 Score = 104 bits (260), Expect = 1e-20 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 + RC +N+C+DV+SD+NNCG C I+CPFTW CC+G C+DT ++PF+CG C +C C Sbjct: 67 KKRCCRNRCIDVTSDVNNCGFCRIKCPFTWQCCQGICIDTNMSPFHCGSCVRRCQPPSLC 126 Query: 133 IYGMCGY 113 GMCGY Sbjct: 127 FNGMCGY 133 >ref|XP_004491465.1| PREDICTED: uncharacterized protein LOC101498346 [Cicer arietinum] Length = 175 Score = 100 bits (248), Expect = 2e-19 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHC 134 R C +N+CVDV+SDINNCG CGIRC F + CC C++T I+PFNCG CG +C G C Sbjct: 71 RSVCCQNRCVDVTSDINNCGFCGIRCRFNFQCCNRLCINTNISPFNCGGCGRECSIGRLC 130 Query: 133 IYGMCGY 113 ++GMC + Sbjct: 131 LFGMCAF 137 >gb|ESQ30412.1| hypothetical protein EUTSA_v10012178mg [Eutrema salsugineum] Length = 177 Score = 98.6 bits (244), Expect = 7e-19 Identities = 41/68 (60%), Positives = 47/68 (69%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDV SD N+C C C F CC G CVDT I+P NCG+CGNKC G Sbjct: 69 ARMRCCRNQCVDVLSDPNHCRFCFRSCRFALSCCDGDCVDTNIDPSNCGQCGNKCDSGAP 128 Query: 136 CIYGMCGY 113 C +G+CGY Sbjct: 129 CEFGLCGY 136 >gb|AAF87870.1|AC012561_3 Hypothetical protein [Arabidopsis thaliana] Length = 173 Score = 96.3 bits (238), Expect = 3e-18 Identities = 40/68 (58%), Positives = 46/68 (67%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDV SD N+C C C F CC G CVDT +P NCG+CGN+C G Sbjct: 69 ARMRCCRNQCVDVLSDPNHCRFCFKSCRFALSCCDGDCVDTNTDPSNCGQCGNECESGAP 128 Query: 136 CIYGMCGY 113 C +GMCGY Sbjct: 129 CEFGMCGY 136 >ref|NP_175480.1| stigma-specific stig1-like protein [Arabidopsis thaliana] gi|12322347|gb|AAG51203.1|AC079279_24 hypothetical protein [Arabidopsis thaliana] gi|332194454|gb|AEE32575.1| stigma-specific stig1-like protein [Arabidopsis thaliana] Length = 174 Score = 96.3 bits (238), Expect = 3e-18 Identities = 40/68 (58%), Positives = 46/68 (67%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDV SD N+C C C F CC G CVDT +P NCG+CGN+C G Sbjct: 70 ARMRCCRNQCVDVLSDPNHCRFCFKSCRFALSCCDGDCVDTNTDPSNCGQCGNECESGAP 129 Query: 136 CIYGMCGY 113 C +GMCGY Sbjct: 130 CEFGMCGY 137 >ref|XP_003621922.1| hypothetical protein MTR_7g025060 [Medicago truncatula] gi|124361153|gb|ABN09125.1| Stigma-specific protein Stig1 [Medicago truncatula] gi|355496937|gb|AES78140.1| hypothetical protein MTR_7g025060 [Medicago truncatula] Length = 210 Score = 96.3 bits (238), Expect = 3e-18 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 2/69 (2%) Frame = -2 Query: 313 RMRCAKNQCVDVSSDINNCGLCGIRCPF--TWLCCKGFCVDTKINPFNCGKCGNKCPWGV 140 R C +N+CVDV++D+NNCG CG+ CP W CC G C + NPF+CG CG CP+G Sbjct: 73 RALCCRNRCVDVTNDLNNCGFCGVICPLIGNWKCCNGVCTNINFNPFSCGDCGRTCPFGF 132 Query: 139 HCIYGMCGY 113 CI+G C + Sbjct: 133 PCIFGRCPF 141 >ref|XP_006304246.1| hypothetical protein CARUB_v10010456mg [Capsella rubella] gi|482572957|gb|EOA37144.1| hypothetical protein CARUB_v10010456mg [Capsella rubella] Length = 174 Score = 95.5 bits (236), Expect = 6e-18 Identities = 40/68 (58%), Positives = 46/68 (67%) Frame = -2 Query: 316 ARMRCAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVH 137 ARMRC +NQCVDV SD N+C C C F CC G C DTK +P NCG+CGN+C G Sbjct: 70 ARMRCCRNQCVDVLSDPNHCRFCFRSCRFGLSCCDGDCADTKSDPSNCGQCGNECEAGAP 129 Query: 136 CIYGMCGY 113 C +GMCGY Sbjct: 130 CEFGMCGY 137 >ref|XP_004516940.1| PREDICTED: uncharacterized protein LOC101514133 [Cicer arietinum] Length = 153 Score = 95.1 bits (235), Expect = 8e-18 Identities = 37/62 (59%), Positives = 44/62 (70%) Frame = -2 Query: 304 CAKNQCVDVSSDINNCGLCGIRCPFTWLCCKGFCVDTKINPFNCGKCGNKCPWGVHCIYG 125 C NQC+DV++DI+NCGLCGIRC F CC CV+T INP NCG CG CP G C++G Sbjct: 71 CCGNQCMDVTTDIDNCGLCGIRCLFNRQCCNRLCVNTNINPLNCGACGRACPIGSLCLFG 130 Query: 124 MC 119 C Sbjct: 131 RC 132