BLASTX nr result
ID: Jatropha_contig00019969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019969 (548 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53214.1| JHL23C09.13 [Jatropha curcas] 105 5e-21 >dbj|BAJ53214.1| JHL23C09.13 [Jatropha curcas] Length = 300 Score = 105 bits (263), Expect = 5e-21 Identities = 55/67 (82%), Positives = 58/67 (86%) Frame = +2 Query: 254 HRPSEQEQVDIIIKNLQPVYQHQLQTQYLPTFQSLIATVTKVEDLIQMGQLKEDSRTSKY 433 +RPSEQEQVDIIIKNL PVYQ QLQTQYLPTFQSLIAT TKVEDLIQ+GQLKEDS Y Sbjct: 237 NRPSEQEQVDIIIKNLLPVYQSQLQTQYLPTFQSLIATATKVEDLIQLGQLKEDS----Y 292 Query: 434 KKPSQPG 454 KKP+ G Sbjct: 293 KKPNHAG 299