BLASTX nr result
ID: Jatropha_contig00019867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019867 (709 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP56378.1| hypothetical protein POPTR_0010s17120g [Populus t... 54 1e-06 >gb|ERP56378.1| hypothetical protein POPTR_0010s17120g [Populus trichocarpa] Length = 126 Score = 53.5 bits (127), Expect(2) = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 510 MGFHSESPSLQISLVKLDGTNYLAWSRSCLLFIEAR 617 +G S++PS ISL+KLD TNYLAWS SCLLFI+AR Sbjct: 22 VGAISDNPSPHISLIKLDETNYLAWSHSCLLFIKAR 57 Score = 25.4 bits (54), Expect(2) = 1e-06 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 Query: 674 NKWKSENSLIMS 709 N+W SENSL+MS Sbjct: 77 NRWNSENSLVMS 88