BLASTX nr result
ID: Jatropha_contig00019483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019483 (614 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP58074.1| hypothetical protein POPTR_0007s01170g [Populus t... 56 7e-06 >gb|ERP58074.1| hypothetical protein POPTR_0007s01170g [Populus trichocarpa] Length = 318 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 327 SDHESRRNSDPDSRPVIF*CLIVFVTCNHFLILITLC 217 SDHESRRN DPDSRPVIF C++V C H L L T C Sbjct: 266 SDHESRRNFDPDSRPVIFKCIVVLYACEHSLKLSTCC 302