BLASTX nr result
ID: Jatropha_contig00019447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019447 (593 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603690.1| hypothetical protein MTR_3g111180 [Medicago ... 55 1e-05 ref|XP_002512628.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_003603690.1| hypothetical protein MTR_3g111180 [Medicago truncatula] gi|355492738|gb|AES73941.1| hypothetical protein MTR_3g111180 [Medicago truncatula] Length = 153 Score = 55.5 bits (132), Expect = 1e-05 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -1 Query: 212 SEFGVIINDCKALLLSRANIA-VRWCRREANEGAHSLARVSFHHASFKVWEAIPDCL 45 S F +INDC+ LL S + VR+ RR+ANE AHS ARV+ HASF + IP C+ Sbjct: 88 SNFCAVINDCRRLLASDLVTSDVRFIRRQANEFAHSFARVALRHASFHIHIRIPSCI 144 >ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis] gi|223548589|gb|EEF50080.1| conserved hypothetical protein [Ricinus communis] Length = 223 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/57 (43%), Positives = 37/57 (64%) Frame = -1 Query: 215 FSEFGVIINDCKALLLSRANIAVRWCRREANEGAHSLARVSFHHASFKVWEAIPDCL 45 +SEFG+II++C++LL N V + +R+AN AH LA S+ +AS W IP C+ Sbjct: 155 WSEFGIIIDECRSLLSLGLNFQVYFVKRQANMVAHVLAMSSYSYASLATWNVIPSCV 211