BLASTX nr result
ID: Jatropha_contig00019422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019422 (712 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 50 6e-13 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 50.4 bits (119), Expect(2) = 6e-13 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 712 LDRAALGYDDWTVSPIILQVFLLIISPHFF 623 LDRAALG++DWTVSPIILQV LL P+FF Sbjct: 194 LDRAALGFEDWTVSPIILQVLLLSSFPYFF 223 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 599 VIERILYSGLAEGSPSSGYCSYFPSL*PISVSHTEDLN 486 VIERI YSGL EGSP SG CSY +L P SVS+ EDL+ Sbjct: 232 VIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLD 269