BLASTX nr result
ID: Jatropha_contig00019333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019333 (582 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 99 8e-19 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 99.0 bits (245), Expect = 8e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 540 VLVHSFVIERIHYSGKVEGSPSSGRCSYPFALQPFSVSYVEDLDHTPVC 394 VL+HSFVIERIHYSG VEGSP SGRCSYPFALQPFSVSY EDLDHTPVC Sbjct: 226 VLIHSFVIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTPVC 274