BLASTX nr result
ID: Jatropha_contig00019291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019291 (400 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530991.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 gb|EOY03716.1| Uncharacterized protein TCM_018828 [Theobroma cacao] 65 7e-09 gb|EOY03724.1| Malectin/receptor protein kinase family protein [... 65 1e-08 gb|EOY03719.1| Uncharacterized protein TCM_018838 [Theobroma cacao] 64 2e-08 >ref|XP_002530991.1| conserved hypothetical protein [Ricinus communis] gi|223529418|gb|EEF31379.1| conserved hypothetical protein [Ricinus communis] Length = 113 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 2/99 (2%) Frame = +1 Query: 4 LLLVLLIFSSTNNSCRAAFLDYKISSRNTSFSCDDGNLDDCLIADDLEVEFLLDSDISRM 183 +LL +L ST C+A+ D+K S N +F C+ G+LD+CLIA D+E+E ++DS I+R+ Sbjct: 14 VLLAILTVCSTTFYCKASTPDHK-SKSNKTFRCEHGHLDECLIASDMELELVMDSYITRI 72 Query: 184 LQEGGNSFAGYTYTPTSVPVCKKGR--SYRNCNCPPYKP 294 L +S T VCK G+ SY +C CP Y+P Sbjct: 73 LGGKSDSATSVAKVATETIVCKDGQSPSYFHCKCPIYRP 111 >gb|EOY03716.1| Uncharacterized protein TCM_018828 [Theobroma cacao] Length = 156 Score = 65.5 bits (158), Expect = 7e-09 Identities = 40/97 (41%), Positives = 56/97 (57%), Gaps = 1/97 (1%) Frame = +1 Query: 4 LLLVLLIFSSTNNSCRAAFLDYKISSRNTSFSCDDGNLDDCLIADDLEVEFLLDSDISRM 183 L ++L++F + NSCRAA + + NT+FSC G L+DCLIA+D+E+E L+DS ISRM Sbjct: 14 LFVMLMLFEA--NSCRAA--EMLMEKSNTTFSCS-GRLNDCLIAEDMELELLMDSHISRM 68 Query: 184 L-QEGGNSFAGYTYTPTSVPVCKKGRSYRNCNCPPYK 291 L G + +T C G+ Y C P K Sbjct: 69 LIGANGKATIDFTNVAHKTVPCGPGKQYGPCINPKQK 105 >gb|EOY03724.1| Malectin/receptor protein kinase family protein [Theobroma cacao] Length = 925 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/97 (41%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = +1 Query: 4 LLLVLLIFSSTNNSCRAAFLDYKISSRNTSFSCDDGNLDDCLIADDLEVEFLLDSDISRM 183 L ++L++F + NSCRAA + + NT+F C G LDDCLIA+D+E+E L+DS ISRM Sbjct: 14 LFVMLMLFEA--NSCRAA--EMLMEKSNTTFRCS-GRLDDCLIAEDMELELLMDSHISRM 68 Query: 184 L-QEGGNSFAGYTYTPTSVPVCKKGRSYRNCNCPPYK 291 L G + +T C G+ Y C P K Sbjct: 69 LIGANGKAKIDFTNVAHKTVPCGPGKQYGPCINPKEK 105 >gb|EOY03719.1| Uncharacterized protein TCM_018838 [Theobroma cacao] Length = 319 Score = 63.5 bits (153), Expect = 2e-08 Identities = 39/97 (40%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = +1 Query: 4 LLLVLLIFSSTNNSCRAAFLDYKISSRNTSFSCDDGNLDDCLIADDLEVEFLLDSDISRM 183 L ++L++F + NSCRAA + + NT+F C G L+DCLIA+D+E+E L+DS ISRM Sbjct: 14 LFVMLMLFEA--NSCRAA--EMLMEKSNTTFRCS-GRLNDCLIAEDMELELLMDSHISRM 68 Query: 184 L-QEGGNSFAGYTYTPTSVPVCKKGRSYRNCNCPPYK 291 L G + +T C G+ Y C P K Sbjct: 69 LIGANGKATIDFTNVAHKTVPCGPGKQYGPCINPKQK 105