BLASTX nr result
ID: Jatropha_contig00019210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019210 (234 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] 76 5e-12 >dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] Length = 525 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/50 (72%), Positives = 46/50 (92%) Frame = +1 Query: 82 SLVPGMEAILPIELEVRSARIIQKSQINKSDWATNYHLQLLGKDEKPLQA 231 SLV GMEA+LPIELEV+SAR+I++SQI++++WA NYHLQLLG DEK L+A Sbjct: 388 SLVYGMEAVLPIELEVQSARVIRESQISEANWAENYHLQLLGMDEKRLRA 437