BLASTX nr result
ID: Jatropha_contig00019162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019162 (573 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 77 2e-12 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 571 DLRLCPMVC*MEDMGSMGGVVLAETIRSLDRAAIWFDDWTVSPIILQV 428 DLR CPM+ MEDM +GG+VL+ETIRSLDRAA+ F+DWTVSPIILQV Sbjct: 166 DLRFCPMIRQMEDMSCIGGIVLSETIRSLDRAALGFEDWTVSPIILQV 213