BLASTX nr result
ID: Jatropha_contig00019081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019081 (577 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535796.1| conserved hypothetical protein [Ricinus comm... 52 2e-09 ref|XP_002535797.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002535796.1| conserved hypothetical protein [Ricinus communis] gi|223521922|gb|EEF26585.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 51.6 bits (122), Expect(2) = 2e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 331 SMFLWRNHIRNKIEKAFKKER*SDGQP 411 S+FLWRNH R KIEKAFKKER SDGQP Sbjct: 36 SVFLWRNHTRKKIEKAFKKERESDGQP 62 Score = 36.2 bits (82), Expect(2) = 2e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 257 VLDETI*IPHYAVGWGES 310 VLDETI IPHYAVGWG + Sbjct: 2 VLDETIQIPHYAVGWGSA 19 >ref|XP_002535797.1| conserved hypothetical protein [Ricinus communis] gi|223521923|gb|EEF26586.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 420 MLLVSRYVPVLQQYWRKKIGPSLADRSRVE 509 MLLVSR VPV QQYWRK+IGPSLADRSRVE Sbjct: 1 MLLVSRQVPVSQQYWRKRIGPSLADRSRVE 30