BLASTX nr result
ID: Jatropha_contig00019074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019074 (592 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 86 3e-17 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 85.5 bits (210), Expect(2) = 3e-17 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -3 Query: 590 RDPGIGD*RLCHMVRQKEDMGSMGGDVLAETIRSFDRAALGFDDWTVSPIILQV 429 +DPG GD R C M+RQ EDM +GG VL+ETIRS DRAALGF+DWTVSPIILQV Sbjct: 160 KDPGFGDLRFCPMIRQMEDMSCIGGIVLSETIRSLDRAALGFEDWTVSPIILQV 213 Score = 28.9 bits (63), Expect(2) = 3e-17 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 373 VIEKIHYXXXXXXXXXXXXXSYFLSLQSFPVSHTKNLDLAP 251 VIE+IHY SY +LQ F VS+ ++LD P Sbjct: 232 VIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTP 272