BLASTX nr result
ID: Jatropha_contig00018974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018974 (623 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002537227.1| conserved hypothetical protein [Ricinus comm... 44 4e-06 >ref|XP_002537227.1| conserved hypothetical protein [Ricinus communis] gi|223517057|gb|EEF25156.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = +2 Query: 11 VLDILANYALLLGRPWLHPLGAIPSHCTEKSKYL 112 VLDI A++ LLLGRPW+H L A+PS +K K++ Sbjct: 1 VLDIPASFNLLLGRPWIHALEAVPSTLHQKVKFI 34 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 29/105 (27%), Positives = 42/105 (40%), Gaps = 15/105 (14%) Frame = +1 Query: 85 TLHRKVKVPWGTDVVTI---------------NVQEDLNVAAVEGLEATVPLSGFQVAVI 219 TLH+KVK G V++I +Q D N+ E ++ +PL F Sbjct: 26 TLHQKVKFIQGNRVISIFGDPEEPVLDPIQVLEIQHDENLELAETVKEYLPLPNFS---- 81 Query: 220 DNAVITEDKSAVNKMSPFSRKMMKKMQWQYGKGLGRDLQRRFEPV 354 DN + E M + M++ G GLGR Q EP+ Sbjct: 82 DNVFVGE--------------MFRSMRYLPGSGLGRHHQGIVEPI 112