BLASTX nr result
ID: Jatropha_contig00018555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018555 (642 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720114.1| rps4 [Jatropha curcas] gi|224979567|gb|ACN72... 76 9e-12 gb|ABV65258.1| ribosomal protein S4, partial (chloroplast) [Picr... 72 1e-10 gb|AFV61816.1| ribosomal protein S4 (chloroplast) [Origanum vulg... 72 1e-10 ref|YP_007507113.1| ribosomal protein S4 (chloroplast) [Salvia m... 72 1e-10 gb|ABV65292.1| ribosomal protein S4, partial (chloroplast) [Eucr... 72 1e-10 gb|ABV65285.1| ribosomal protein S4, partial (chloroplast) [Cryp... 72 1e-10 gb|ABV65282.1| ribosomal protein S4, partial (chloroplast) [Cori... 72 1e-10 gb|ABV65291.1| ribosomal protein S4, partial (chloroplast) [Elat... 72 2e-10 gb|AAP80900.1| small ribosomal protein 4, partial (chloroplast) ... 72 2e-10 ref|YP_004564006.1| ribosomal protein S4 [Olea woodiana subsp. w... 71 2e-10 gb|ABG74794.1| ribosomal protein S4 [Jasminum abyssinicum] 71 2e-10 gb|ABG74820.1| ribosomal protein S4 [Jasminum subhumile] 71 2e-10 gb|AHA84950.1| ribosomal protein S4 [Ajuga reptans] 71 3e-10 ref|YP_008815939.1| ribosomal protein S4 (chloroplast) [Lindenbe... 71 3e-10 ref|YP_086968.1| ribosomal protein S4 [Panax ginseng] gi|3594221... 71 3e-10 ref|YP_398864.1| ribosomal protein S4 [Nicotiana tomentosiformis... 71 3e-10 ref|NP_054500.1| ribosomal protein S4 [Nicotiana tabacum] gi|781... 71 3e-10 ref|YP_006666032.1| ribosomal protein S4 (chloroplast) [Capsicum... 71 3e-10 gb|AEZ52945.1| ribosomal protein S4, partial (chloroplast) [Gent... 71 3e-10 gb|AEN93527.1| ribosomal protein S4 [Tetracera asiatica] 71 3e-10 >ref|YP_002720114.1| rps4 [Jatropha curcas] gi|224979567|gb|ACN72694.1| rps4 [Jatropha curcas] Length = 201 Score = 75.9 bits (185), Expect = 9e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT Sbjct: 167 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 201 >gb|ABV65258.1| ribosomal protein S4, partial (chloroplast) [Picramnia polyantha] Length = 168 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HPIQYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 134 HPIQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 168 >gb|AFV61816.1| ribosomal protein S4 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 201 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPVQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_007507113.1| ribosomal protein S4 (chloroplast) [Salvia miltiorrhiza] gi|401879744|gb|AFQ30931.1| ribosomal protein S4 (chloroplast) [Salvia miltiorrhiza] Length = 201 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPVQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >gb|ABV65292.1| ribosomal protein S4, partial (chloroplast) [Eucryphia lucida] Length = 193 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 159 HPVQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 193 >gb|ABV65285.1| ribosomal protein S4, partial (chloroplast) [Crypteronia paniculata] Length = 191 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 157 HPVQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 191 >gb|ABV65282.1| ribosomal protein S4, partial (chloroplast) [Coriaria nepalensis] Length = 195 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 161 HPVQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 195 >gb|ABV65291.1| ribosomal protein S4, partial (chloroplast) [Elatine triandra] Length = 183 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 149 HPLQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 183 >gb|AAP80900.1| small ribosomal protein 4, partial (chloroplast) [Rubus odoratus] Length = 184 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP+QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 150 HPLQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 184 >ref|YP_004564006.1| ribosomal protein S4 [Olea woodiana subsp. woodiana] gi|334084661|emb|CBS29352.1| ribosomal protein S4 [Olea woodiana subsp. woodiana] Length = 203 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT*T 532 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT T Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQTET 203 >gb|ABG74794.1| ribosomal protein S4 [Jasminum abyssinicum] Length = 203 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT*T 532 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT T Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQTKT 203 >gb|ABG74820.1| ribosomal protein S4 [Jasminum subhumile] Length = 203 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT*T 532 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT T Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQTKT 203 >gb|AHA84950.1| ribosomal protein S4 [Ajuga reptans] Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_008815939.1| ribosomal protein S4 (chloroplast) [Lindenbergia philippensis] gi|557136865|emb|CDI43920.1| ribosomal protein S4 (chloroplast) [Lindenbergia philippensis] Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_086968.1| ribosomal protein S4 [Panax ginseng] gi|359422146|ref|YP_004935554.1| ribosomal protein S4 (chloroplast) [Eleutherococcus senticosus] gi|558602914|ref|YP_008814945.1| ribosomal protein S4 (chloroplast) [Brassaiopsis hainla] gi|558603002|ref|YP_008815032.1| ribosomal protein S4 (chloroplast) [Metapanax delavayi] gi|558603090|ref|YP_008815119.1| ribosomal protein S4 (chloroplast) [Schefflera delavayi] gi|563940281|ref|YP_008814858.1| ribosomal protein S4 (chloroplast) [Aralia undulata] gi|563940387|ref|YP_008815206.1| ribosomal protein S4 (chloroplast) [Kalopanax septemlobus] gi|62287232|sp|Q68S04.1|RR4_PANGI RecName: Full=30S ribosomal protein S4, chloroplastic gi|51235315|gb|AAT98511.1| ribosomal protein S4 [Panax ginseng] gi|347448209|gb|AEO92621.1| ribosomal protein S4 (chloroplast) [Eleutherococcus senticosus] gi|458599092|gb|AGG38958.1| ribosomal protein S4 (chloroplast) [Aralia undulata] gi|458599194|gb|AGG39045.1| ribosomal protein S4 (chloroplast) [Brassaiopsis hainla] gi|458599373|gb|AGG39132.1| ribosomal protein S4 (chloroplast) [Metapanax delavayi] gi|458599526|gb|AGG39219.1| ribosomal protein S4 (chloroplast) [Schefflera delavayi] gi|458599614|gb|AGG39306.1| ribosomal protein S4 (chloroplast) [Kalopanax septemlobus] Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_398864.1| ribosomal protein S4 [Nicotiana tomentosiformis] gi|90101664|sp|Q33C33.1|RR4_NICTO RecName: Full=30S ribosomal protein S4, chloroplastic gi|80750926|dbj|BAE48002.1| ribosomal protein S4 [Nicotiana tomentosiformis] Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|NP_054500.1| ribosomal protein S4 [Nicotiana tabacum] gi|78102536|ref|YP_358677.1| ribosomal protein S4 [Nicotiana sylvestris] gi|133960|sp|P06359.1|RR4_TOBAC RecName: Full=30S ribosomal protein S4, chloroplastic gi|90101663|sp|Q3C1H5.1|RR4_NICSY RecName: Full=30S ribosomal protein S4, chloroplastic gi|11834|emb|CAA77354.1| ribosomal protein S4 [Nicotiana tabacum] gi|77799563|dbj|BAE46652.1| ribosomal protein S4 [Nicotiana sylvestris] gi|225202|prf||1211235AG ribosomal protein S4 Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_006666032.1| ribosomal protein S4 (chloroplast) [Capsicum annuum] gi|401065934|gb|AFP90778.1| ribosomal protein S4 (chloroplast) [Capsicum annuum] Length = 201 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 167 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >gb|AEZ52945.1| ribosomal protein S4, partial (chloroplast) [Gentiana pannonica] Length = 187 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 153 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 187 >gb|AEN93527.1| ribosomal protein S4 [Tetracera asiatica] Length = 180 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 642 HPIQYKGLVNQIIDSKWGGLKINELLVVEYYSRQT 538 HP QYKGLVNQIIDSKW GLKINELLVVEYYSRQT Sbjct: 146 HPFQYKGLVNQIIDSKWVGLKINELLVVEYYSRQT 180