BLASTX nr result
ID: Jatropha_contig00018531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018531 (343 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516451.1| calcineurin B, putative [Ricinus communis] g... 60 3e-07 >ref|XP_002516451.1| calcineurin B, putative [Ricinus communis] gi|223544271|gb|EEF45792.1| calcineurin B, putative [Ricinus communis] Length = 249 Score = 60.1 bits (144), Expect = 3e-07 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +1 Query: 142 MDFSNNPSKSSSLTLGEKIGAALFQLAALTKVLI*AETICFN*QPRIHKIS*RLTVLARL 321 MDFSNN S SSSL++GE+I AAL AAL +VLI A + CF+ +PR K RL L RL Sbjct: 1 MDFSNNSSGSSSLSIGERICAALLPFAALIEVLIIAVSNCFDYRPRFKKTVCRLDDLVRL 60 Query: 322 SLKPPFS 342 S + F+ Sbjct: 61 SHESRFT 67