BLASTX nr result
ID: Jatropha_contig00018517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018517 (125 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partia... 61 1e-07 >gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 7 APRNIAPPTPSGQSYEPLIYSHSITPAGELVKLEKLTLG 123 APRNIA PTPS QS+EPLI+SHSIT AGE VK+EKLTLG Sbjct: 26 APRNIAIPTPSRQSHEPLIHSHSIT-AGEQVKIEKLTLG 63